Bioactive grade

Recombinant human PCSK9 protein (Active) (ab221019)

Description

  • Product name

    Recombinant human PCSK9 protein (Active)
    See all PCSK9 proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA.  Immobilized Human LDL R, His Tag at 10 μg/mL (100 μL/well) can bind ab221019 with a linear range of 4-200 ng/mL.

  • Purity

    > 97 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QEDEDGDYEELVLALRSEEDGLAEAPEHGTTATFHRCAKDPWRLPGTYVV VLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDL LELALKLPHVDYIEEDSSVFAQSIPWNLERITPPRYRADEYQPPDGGSLV EVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHL AGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPV GPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASA PEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFV SQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFP EDQRVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAVARCAPD EELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLP QANCSVHTAPPAEASMGTRVHCHQQGHVLTGCSSHWEVEDLGTHKPPVLR PRGQPNQCVGHREASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGW TLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTAVAICCR SRHLAQASQELQ
    • Predicted molecular weight

      74 kDa including tags
    • Amino acids

      31 to 692
    • Tags

      StrepII tag C-Terminus
    • Additional sequence information

      This product is the mature full length protein the signal peptide is not included (Accession # AAI66619).

Specifications

Our Abpromise guarantee covers the use of ab221019 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • Convertase subtilisin/kexin type 9 preproprotein
    • FH3
    • HCHOLA3
    • Hypercholesterolemia autosomal dominant 3
    • LDLCQ1
    • NARC 1
    • NARC-1
    • NARC1
    • Neural apoptosis regulated convertase 1
    • Neural apoptosis-regulated convertase 1
    • PC 9
    • PC9
    • PCSK 9
    • PCSK9
    • PCSK9_HUMAN
    • Proprotein convertase 9
    • Proprotein convertase PC9
    • Proprotein convertase subtilisin/kexin type 9
    • PSEC0052
    • Subtilisin/kexin like protease PC9
    • Subtilisin/kexin-like protease PC9
    see all
  • Function

    May be implicated in the differentiation of cortical neurons and may play a role in cholesterol homeostasis.
  • Tissue specificity

    Expressed in neuro-epithelioma, colon carcinoma, hepatic and pancreatic cell lines, and in Schwann cells.
  • Involvement in disease

    Defects in PCSK9 are the cause of familial hypercholesterolemia 3 (FH3) [MIM:603776]. FH3 inheritance is autosomal dominant.
  • Sequence similarities

    Belongs to the peptidase S8 family.
    Contains 1 peptidase S8 domain.
  • Post-translational
    modifications

    The soluble zymogen undergoes autocatalytic intramolecular processing in the endoplasmic reticulum, resulting in the cleavage of its propeptide that remains associated with the secreted enzyme.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • Human PCSK9, Strep Tag on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 97%.
  • FACS analysis shows that Human PCSK9, Strep Tag� inhibits LDL uptake in HepG2 cells. The EC50 for this effect is 0.6923-3.589 µg/mL.
  • Immobilized Human LDL R, His Tag at 10 μg/mL (100 μL/well) can bind ab221019 with a linear range of 4-200 ng/mL.

  • SDS-PAGE analysis of ab221019 under reducing conditions, stained overnight with Coomassie Blue. As a result of glycosylation, the reduced protein migrates as 60-68 kDa.

References

ab221019 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221019.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up