Description

  • Product name

    Recombinant Human PCTAIRE2 protein
    See all PCTAIRE2 proteins and peptides
  • Purity

    > 75 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MKKFKRRLSLTLRGSQTIDESLSELAEQMTIEENSSKDNEPIVKNGRPPT SHSMHSFLHQYTGSFKKPPLRRPHSVIGGSLGSFMAMPRNGSRLDIVHEN LKMGSDGESDQASGTSSDEVQSPTGVCLRNRIHRRISMEDLNKRLSLPAD IRIPDGYLEKLQINSPPFDQPMSRRSRRASLSEIGFGKMETYIKLEKLGE GTYATVYKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANI VTLHDIVHTDKSLTLVFEYLDKDLKQYMDDCGNIMSMHNVKLFLYQILRG LAYCHRRKVLHRDLKPQNLLINEKGELKLADFGLARAKSVPTKTYSNEVV TLWYRPPDVLLGSSEYSTQIDMWGVGCIFFEMASGRPLFPGSTVEDELHL IFRLLGTPSQETWPGISSNEEFKNYNFPKYKPQPLINHAPRLDSEGIELI TKFLQYESKKRVSAEEAMKHVYFRSLGPRIHALPESVSIFSLKEIQLQKD PGFRNSSYPETGHGKNRRQSMLF
    • Predicted molecular weight

      88 kDa including tags
    • Amino acids

      1 to 523
    • Tags

      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab190412 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.79% Tris HCl, 0.29% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol

General Info

  • Alternative names

    • 6430598J10Rik
    • CDK17
    • CDK17_HUMAN
    • Cell division protein kinase 17
    • Cyclin-dependent kinase 17
    • EC 2.7.1.37
    • MGC25109
    • PCTAIRE-motif protein kinase 2
    • PCTK2
    • Protein kinase cdc2-related PCTAIRE-2
    • Serine/threonine-protein kinase PCTAIRE-2
    see all
  • Function

    May play a role in terminally differentiated neurons. Has a Ser/Thr-phosphorylating activity for histone H1.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
    Contains 1 protein kinase domain.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab190412

References

ab190412 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190412.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up