Description

  • Product name

    Recombinant human PD-L1 protein
    See all PD-L1 proteins and peptides
  • Biological activity

    Measured by its ability to inhibit anti CD3 antibody induced IL2 secretion in Human T lymphocytes . The ED50 for this effect is typically 0.6 - 5 μg/ml.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFV HGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISY GGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWT SSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEE NHTAELVIPELPLAHPPNER
    • Predicted molecular weight

      28 kDa including tags
    • Amino acids

      19 to 238
    • Tags

      StrepII tag C-Terminus
    • Additional sequence information

      Extracellular domain. C terminal Strep II-tag. NP_054862.1.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab182689 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Reconstitute for long term storage.

    pH: 7.40
    Constituents: 5% Trehalose, 95% PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • B7 H
    • B7 H1
    • B7 homolog 1
    • B7-H1
    • B7H
    • B7H1
    • CD 274
    • CD274
    • CD274 antigen
    • CD274 molecule
    • MGC142294
    • MGC142296
    • OTTHUMP00000021029
    • PD L1
    • PD-L1
    • PD1L1_HUMAN
    • PDCD1 ligand 1
    • PDCD1L1
    • PDCD1LG1
    • PDL 1
    • PDL1
    • Programmed cell death 1 ligand 1
    • Programmed death ligand 1
    • RGD1566211
    see all
  • Function

    Involved in the costimulatory signal, essential for T-cell proliferation and production of IL10 and IFNG, in an IL2-dependent and a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation and cytokine production.
  • Tissue specificity

    Highly expressed in the heart, skeletal muscle, placenta and lung. Weakly expressed in the thymus, spleen, kidney and liver. Expressed on activated T- and B-cells, dendritic cells, keratinocytes and monocytes.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. BTN/MOG family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Cell membrane and Endomembrane system.
  • Information by UniProt

Images

  • Human PD-L1, Strep Tag on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.
  • Immobilized Human PD-L1, Strep Tag at 5 µg/mL ( 100 µl/well ) can bind Biotinylated Human PD-1, His Tag & Fc tag with a linear range of 2-60 ng/mL.

References

ab182689 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182689.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up