Recombinant Human PD-L1 protein (ab216206)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 90% SDS-PAGE
- Tags: DDDDK tag C-Terminus
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant Human PD-L1 protein
See all PD-L1 proteins and peptides -
Purity
> 90 % SDS-PAGE.
Purity measured by gel filtration. -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFV HGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISY GGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWT SSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEE NHTAELVIPELPLAHPPNERTDYKDDDDK -
Predicted molecular weight
26 kDa including tags -
Amino acids
19 to 239 -
Tags
DDDDK tag C-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab216206 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 78% Phosphate Buffer, 0.64% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol
General Info
-
Alternative names
- B7 H
- B7 H1
- B7 homolog 1
see all -
Function
Involved in the costimulatory signal, essential for T-cell proliferation and production of IL10 and IFNG, in an IL2-dependent and a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation and cytokine production. -
Tissue specificity
Highly expressed in the heart, skeletal muscle, placenta and lung. Weakly expressed in the thymus, spleen, kidney and liver. Expressed on activated T- and B-cells, dendritic cells, keratinocytes and monocytes. -
Sequence similarities
Belongs to the immunoglobulin superfamily. BTN/MOG family.
Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Cellular localization
Cell membrane and Endomembrane system. - Information by UniProt
Images
-
SDS-PAGE - Recombinant Human PD-L1 protein (ab216206)
4-20% SDS-PAGE analysis of ab216206 (3 μg) with Coomassie staining.
-
Functional Studies - Recombinant Human PD-L1 protein (ab216206)Assay Conditions: 10 nM PD-1, Biotinlabeled was mixed with varying amounts of PD-L1, FLAG-tag ab216206 in PD-1 Assay Buffer for 1 hr at RT. FLAG-acceptor beads were added and incubated for 30 min at RT followed by strep-conjugated donor beads for 30 min at RT. Alpha counts were read.
-
Size Exclusion Chromatography - Recombinant Human PD-L1 protein (ab216206)Gel Filtration Curve.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab216206 has not yet been referenced specifically in any publications.
