Description

  • Product name

    Recombinant human PD-L2 protein
    See all PD-L2 proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA.
    Immobilized ab191645 at 1 µg/mL (100 µl/well) can bind recombinant Human PDCD-1 with a linear range of 7.5 - 500 ng/ml.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPH RERATLLEEQ LPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTL KVKASYRKINTHILKVPETDEV ELTCQATGYPLAEVSWPNVSVPANTS HSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHV RELTLASIDLQSQM EPRTHP
    • Predicted molecular weight

      49 kDa including tags
    • Amino acids

      20 to 219
    • Additional sequence information

      Corresponds to extracellular domain. Contains C terminal Fc tag.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab191645 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute the lyophilized product in 1000 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage

General Info

  • Alternative names

    • B7 dendritic cell molecule
    • B7-DC
    • B7DC
    • bA574F11.2
    • Btdc
    • Butyrophilin B7 DC
    • Butyrophilin B7-DC
    • Butyrophilin B7DC
    • CD 273
    • CD273
    • CD273 antigen
    • MGC142238
    • MGC142240
    • PD 1 ligand 2
    • PD L2
    • PD-1 ligand 2
    • PD-L2
    • PD1 ligand 2
    • PD1L2_HUMAN
    • PDCD 1 ligand 2
    • PDCD1 ligand 2
    • PDCD1L2
    • Pdcd1lg2
    • PDL 2
    • PDL2
    • Programmed cell death 1 ligand 2
    • Programmed death ligand 2
    see all
  • Function

    Involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production.
  • Tissue specificity

    Highly expressed in heart, placenta, pancreas, lung and liver and weakly expressed in spleen, lymph nodes and thymus.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. BTN/MOG family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Secreted; Cell membrane and Endomembrane system.
  • Information by UniProt

Images

  • Immobilized cell surface PD-1 (5x104 of cells per well) can bind Human PD-L2, Fc Tag ab191645 with an EC50 of 0.018 μg/mL.

  • Flow Cytometry assay shows that recombinant Human PD-L2, Fc Tag ab191645 can bind to 293 cell overexpressing human PD-1. The concentration of PD-L2 used is 1 μg/mL

  • Loaded Human PD-1, His Tag, low endotoxin on HIS1K Biosensor, can bind Human PD-L2, Fc Tag ab191645 with an affinity constant of 15.7 nM as determined in BLI assay

  • Loaded Human PD-1, His Tag (ab174035), can bind Human PD-L2, Fc Tag ab191645 with an affinity constant of 16.3 nM as determined in BLI assay

  • The purity of ab191645 was greater than 90% as determined by SEC-HPLC.

  • DTT-reduced (+) SDS-PAGE staining ab191645 overnight with Coomassie Blue.

References

ab191645 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191645.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up