Description

  • Product name

    Recombinant human PD-L2 protein
    See all PD-L2 proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized B7 DC at 1 µg/mL (100 µl/well) can bind PDCD-1 with a linear range of 15 - 500 ng/ml.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPH RERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKV KASYRKINTHILKVPETDEVELTCQATGYPLAEVSWPNVSVPANTSHSRT PEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPRTHP
    • Predicted molecular weight

      23 kDa including tags
    • Amino acids

      20 to 219
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Accession # AAI13679

Specifications

Our Abpromise guarantee covers the use of ab191980 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Please see notes section.

    pH: 7.40
    Constituent: 100% PBS

    5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized PBS, pH7.4 to a stock solution of 200ug/ml. After reconstitution store under sterile conditions -70 degrees.

General Info

  • Alternative names

    • B7 dendritic cell molecule
    • B7-DC
    • B7DC
    • bA574F11.2
    • Btdc
    • Butyrophilin B7 DC
    • Butyrophilin B7-DC
    • Butyrophilin B7DC
    • CD 273
    • CD273
    • CD273 antigen
    • MGC142238
    • MGC142240
    • PD 1 ligand 2
    • PD L2
    • PD-1 ligand 2
    • PD-L2
    • PD1 ligand 2
    • PD1L2_HUMAN
    • PDCD 1 ligand 2
    • PDCD1 ligand 2
    • PDCD1L2
    • Pdcd1lg2
    • PDL 2
    • PDL2
    • Programmed cell death 1 ligand 2
    • Programmed death ligand 2
    see all
  • Function

    Involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production.
  • Tissue specificity

    Highly expressed in heart, placenta, pancreas, lung and liver and weakly expressed in spleen, lymph nodes and thymus.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. BTN/MOG family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Secreted; Cell membrane and Endomembrane system.
  • Information by UniProt

Images

  • Human PD-L2, His Tag on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.
  • The purity of ab191980 was determined by DTT-reduced (+) SDS-PAGE and staining overnight with Coomassie Blue. DTT-reduced Protein migrates as 35-48 kDa due to glycosylation.

References

ab191980 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191980.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up