Bioactive grade

Recombinant human PD-L2 protein (Active) (Biotin) (ab246146)

Description

  • Product name

    Recombinant human PD-L2 protein (Active) (Biotin)
    See all PD-L2 proteins and peptides
  • Biological activity

    Immobilized Human PD-1, Fc Tag at 2 μg/mL (100 μL/well) can bind ab246146 with a linear range of 0.5-16 ng/mL.

  • Purity

    > 95 % SDS-PAGE.
    The biotin to protein ratio is 0.5-1 as determined by the HABA assay.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPH RERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKV KASYRKINTHILKVPETDEVELTCQATGYPLAEVSWPNVSVPANTSHSRT PEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPRTHP
    • Predicted molecular weight

      51 kDa including tags
    • Amino acids

      20 to 219
    • Tags

      Avi tag C-Terminus , Fc tag C-Terminus
    • Additional sequence information

      AviTag sequence GLNDIFEAQKIEWHE. Human IgG1 Fc tag.
  • Conjugation

    Biotin

Specifications

Our Abpromise guarantee covers the use of ab246146 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Additional notes

    Biotinylation of this product is performed using Avitag™ technology. Briefly, the single lysine residue in the Avitag is enzymatically labeled with biotin.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 7.50
    Constituents: 5% Trehalose, 0.61% Tris, 0.75% Glycine

    0.22 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long-term storage.

General Info

  • Alternative names

    • B7 dendritic cell molecule
    • B7-DC
    • B7DC
    • bA574F11.2
    • Btdc
    • Butyrophilin B7 DC
    • Butyrophilin B7-DC
    • Butyrophilin B7DC
    • CD 273
    • CD273
    • CD273 antigen
    • MGC142238
    • MGC142240
    • PD 1 ligand 2
    • PD L2
    • PD-1 ligand 2
    • PD-L2
    • PD1 ligand 2
    • PD1L2_HUMAN
    • PDCD 1 ligand 2
    • PDCD1 ligand 2
    • PDCD1L2
    • Pdcd1lg2
    • PDL 2
    • PDL2
    • Programmed cell death 1 ligand 2
    • Programmed death ligand 2
    see all
  • Function

    Involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production.
  • Tissue specificity

    Highly expressed in heart, placenta, pancreas, lung and liver and weakly expressed in spleen, lymph nodes and thymus.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. BTN/MOG family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Secreted; Cell membrane and Endomembrane system.
  • Information by UniProt

Images

  • SDS-PAGE - Human PD-L2 protein (Active) (Biotin) (ab246146).

    The gel was stained overnight with Coomassie Blue.

    The protein migrates as 66-91 kDa on SDS-PAGE gel under reducing conditions due to glycosylation.

  • Immobilized Human PD-1, Fc Tag at 2 μg/mL (100 μL/well) can bind ab246146 with a linear range of 0.5-16 ng/mL.

References

ab246146 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246146.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up