Recombinant human PD-L2 protein (Fc Chimera Active) (ab234497)

Description

  • Product name

    Recombinant human PD-L2 protein (Fc Chimera Active)
    See all PD-L2 proteins and peptides
  • Biological activity

    Determined by its ability to bind programmed cell death ligand 1 (PD-1) in a functional ELISA.

  • Purity

    >= 95 % SDS-PAGE.
    >= 95% by HPLC analysis.
  • Expression system

    CHO cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPH RERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKV KASYRKINTHILKVPETDEVELTCQATGYPLAEVSWPNVSVPANTSHSRT PEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPRTHP GGPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVV DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVS LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    • Predicted molecular weight

      49 kDa including tags
    • Amino acids

      20 to 219
    • Additional sequence information

      Fused to the 231-amino-acid length Fc portion of human IgG1 by two glycines. Glycosylated, disulfide-linked homodimer.

Specifications

Our Abpromise guarantee covers the use of ab234497 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Additional notes

    Migrates at an apparent molecular weight of approximately 65-75 kDa by SDS-PAGE analysis under reducing conditions due to glycosylation.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    For lot specific reconstitution information please contact our Scientific Support Team.

General Info

  • Alternative names

    • B7 dendritic cell molecule
    • B7-DC
    • B7DC
    • bA574F11.2
    • Btdc
    • Butyrophilin B7 DC
    • Butyrophilin B7-DC
    • Butyrophilin B7DC
    • CD 273
    • CD273
    • CD273 antigen
    • MGC142238
    • MGC142240
    • PD 1 ligand 2
    • PD L2
    • PD-1 ligand 2
    • PD-L2
    • PD1 ligand 2
    • PD1L2_HUMAN
    • PDCD 1 ligand 2
    • PDCD1 ligand 2
    • PDCD1L2
    • Pdcd1lg2
    • PDL 2
    • PDL2
    • Programmed cell death 1 ligand 2
    • Programmed death ligand 2
    see all
  • Function

    Involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production.
  • Tissue specificity

    Highly expressed in heart, placenta, pancreas, lung and liver and weakly expressed in spleen, lymph nodes and thymus.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. BTN/MOG family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Secreted; Cell membrane and Endomembrane system.
  • Information by UniProt

References

ab234497 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234497.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up