Description

  • Product name

    Recombinant human PD1 protein (Fc Chimera Active)
    See all PD1 proteins and peptides
  • Biological activity

    Determined by its ability to prevent plate adhesion of PHA-stimulated Jurkat cells in the presence of 625ng/mL of bound hPD-L1. The ED50 for this effect is 2500ng/mL.

  • Expression system

    CHO cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      PGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRM SPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGT YLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLV VGVVGGLLGSLVLLVWVLAVICSRAARGTIGARRTGQPLKEDPSAVPVFS VDYGELDFQWREKTPEPPVPCVPEQTEYATIVFPSGMGTSSPARRGSADG PRSAQPLRPEDGHCSWPLGGPKSCDKTHTCPPCPAPELLGGPSVFLFPPK PKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG K
    • Predicted molecular weight

      55 kDa
    • Amino acids

      21 to 288
    • Tags

      Fc tag C-Terminus
    • Additional sequence information

      268-amino-acid length mature PD1 sequence fused to the 231-amino-acid length Fc portion of human IgG1 by two glycines. The PD1 signal peptide is not incuded.

Specifications

Our Abpromise guarantee covers the use of ab238348 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Additional notes

    Due to glycosylation, ab238348 migrates at an apparent molecular weight of approximately 180-200 kDa by SDS-PAGE analysis under non-reducing conditions.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.16% Sodium phosphate, 0.87% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute in water to 0.1 - 1.0 mg/ml.

General Info

  • Alternative names

    • CD279
    • CD279 antigen
    • hPD 1
    • hPD l
    • hPD-1
    • hSLE1
    • PD 1
    • PD-1
    • PD1
    • PDCD 1
    • PDCD1
    • PDCD1_HUMAN
    • Programmed cell death 1
    • Programmed cell death 1 protein
    • Programmed cell death protein 1
    • Protein PD 1
    • Protein PD-1
    • SLEB2
    • Systemic lupus erythematosus susceptibility 2
    see all
  • Function

    Possible cell death inducer, in association with other factors.
  • Involvement in disease

    Genetic variation in PDCD1 is associated with susceptibility to systemic lupus erythematosus type 2 (SLEB2) [MIM:605218]. Systemic lupus erythematosus is a chronic, inflammatory and often febrile multisystemic disorder of connective tissue. It affects principally the skin, joints, kidneys and serosal membranes. It is thought to represent a failure of the regulatory mechanisms of the autoimmune system.
  • Sequence similarities

    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Developmental stage

    Induced at programmed cell death.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab238348 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238348.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up