Description

  • Product name

    Recombinant Human PDAP1 protein
  • Purity

    > 90 % SDS-PAGE.
    ab99246 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGD PKKEKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLD LDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQR EEAARKKEEERKAKDDATLSGKRMQSLSLNKLEHHHHHH
    • Predicted molecular weight

      22 kDa including tags
    • Amino acids

      1 to 181
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99246 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.00174% PMSF, 0.0308% DTT, 0.316% Tris HCl, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • 28 kDa heat- and acid-stable phosphoprotein
    • 28kDa heat and acid stable phosphoprotein
    • HAP28_HUMAN
    • HASPP28
    • PAP
    • PAP1
    • PDAP 1
    • Pdap1
    • PDGF associated protein
    • PDGF-associated protein
    • PDGFA associated protein 1
    • PDGFA-associated protein 1
    see all
  • Function

    Enhances PDGFA-stimulated cell growth in fibroblasts, but inhibits the mitogenic effect of PDGFB.
  • Sequence similarities

    Belongs to the PDAP1 family.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab99246 (3µg).

References

ab99246 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99246.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up