Recombinant Human PDCD10/CCM3 protein (ab113198)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human PDCD10/CCM3 protein -
Purity
> 95 % SDS-PAGE.
Purity is >95%, by SDS-PAGE and silver stain. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MGSSHHHHHHSSGLVPRGSMRMTMEEMKNEAETTSMVSMPLYAVMYPVFN ELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLL RMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTI KDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTY FKDGKAINVFVSANRLIHQTNLILQTFKTVA -
Predicted molecular weight
27 kDa including tags -
Amino acids
1 to 212 -
Tags
His tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab113198 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Additional notes
This product was previously labelled as PDCD10
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
-
ReconstitutionThe lyophilized ab113198 should be reconstituted in water or PBS to a concentration not lower than 50 µg/ml.
General Info
-
Alternative names
- Apoptosis related protein 15
- CCM3
- Cerebral cavernous malformations 3 protein
see all -
Function
Promotes cell proliferation. Modulates apoptotic pathways. Increases mitogen-activated protein kinase activity and MST4 activity. Important for cell migration, and for normal structure and assembly of the Golgi complex. Important for KDR/VEGFR2 signaling. Increases the stability of KDR/VEGFR2 and prevents its breakdown. Required for normal cardiovascular development. Required for normal angiogenesis, vasculogenesis and hematopoiesis during embryonic development. -
Tissue specificity
Ubiquitous. -
Involvement in disease
Defects in PDCD10 are the cause of cerebral cavernous malformations type 3 (CCM3) [MIM:603285]. Cerebral cavernous malformations (CCMs) are congenital vascular anomalies of the central nervous system that can result in hemorrhagic stroke, seizures, recurrent headaches, and focal neurologic deficits. CCMs have an incidence of 0.1%-0.5% in the general population and usually present clinically during the 3rd to 5th decade of life. The lesions are characterized by grossly enlarged blood vessels consisting of a single layer of endothelium and without any intervening neural tissue, ranging in diameter from a few millimeters to several centimeters. -
Sequence similarities
Belongs to the PDCD10 family. -
Cellular localization
Cytoplasm. Golgi apparatus membrane. Cell membrane. Partially co-localizes with endogenous PXN at the leading edges of migrating cells. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab113198 has not yet been referenced specifically in any publications.