Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGEFGSMRMTMEEMKNEAETTSMVSMPLYAVMYPVFNEL ERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRM AADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKD IASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFK DGKAINVFVSANRLIHQTNLILQTFKTVA
    • Molecular weight
      26 kDa including tags
    • Amino acids
      1 to 212
    • Tags
      T7 tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab169900 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    ab169900 was expressed in E.coli as inclusion bodies, then refolded using “temperature shift inclusion body refolding” technology, chromatographically purified and sterile-filtered.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituent: 0.32% Tris HCl
    Note: Contains NaCl, KCl, EDTA, arginine, DTT and glycerol.

General Info

  • Alternative names
    • Apoptosis related protein 15
    • CCM3
    • Cerebral cavernous malformations 3 protein
    • MGC1212
    • MGC24477
    • PDC10_HUMAN
    • PDCD 10
    • PDCD10
    • Programmed cell death 10
    • Programmed cell death protein 10
    • TF 1 cell apoptosis related protein 15
    • TF-1 cell apoptosis-related protein 15
    • TFAR15
    see all
  • Function
    Promotes cell proliferation. Modulates apoptotic pathways. Increases mitogen-activated protein kinase activity and MST4 activity. Important for cell migration, and for normal structure and assembly of the Golgi complex. Important for KDR/VEGFR2 signaling. Increases the stability of KDR/VEGFR2 and prevents its breakdown. Required for normal cardiovascular development. Required for normal angiogenesis, vasculogenesis and hematopoiesis during embryonic development.
  • Tissue specificity
    Ubiquitous.
  • Involvement in disease
    Defects in PDCD10 are the cause of cerebral cavernous malformations type 3 (CCM3) [MIM:603285]. Cerebral cavernous malformations (CCMs) are congenital vascular anomalies of the central nervous system that can result in hemorrhagic stroke, seizures, recurrent headaches, and focal neurologic deficits. CCMs have an incidence of 0.1%-0.5% in the general population and usually present clinically during the 3rd to 5th decade of life. The lesions are characterized by grossly enlarged blood vessels consisting of a single layer of endothelium and without any intervening neural tissue, ranging in diameter from a few millimeters to several centimeters.
  • Sequence similarities
    Belongs to the PDCD10 family.
  • Cellular localization
    Cytoplasm. Golgi apparatus membrane. Cell membrane. Partially co-localizes with endogenous PXN at the leading edges of migrating cells.
  • Information by UniProt

References

ab169900 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169900.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up