Overview

  • Product name

    Recombinant Human PDCD11 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MANLEESFPRGGTRKIHKPEKAFQQSVEQDNLFDISTEEGSTKRKKSQKG PAKTKKLKIEKRESSKSAREKFEILSVESLCEGMRILGCVKEVNELELVI SLPNGLQGFV
    • Amino acids

      1 to 110
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161489 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ALG 4
    • ALG4
    • apoptosis-linked gene 4
    • KIAA0185
    • NF kappa B binding protein
    • NFBP
    • PDCD 11
    • Programmed cell death 11
    • Programmed cell death protein 11
    • Protein RRP5 homolog
    see all
  • Relevance

    PDCD11 is a NF-kappa-B binding protein that colocalizes with U3 RNA in the nucleolus and is required for rRNA maturation and generation of 18S rRNA.
  • Cellular localization

    Nuclear; nucleolus.

Images

  • ab161489 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161489 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161489.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up