Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQ SARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVS QQTEKTTTVKFNRRKVMDSDEDDDY
    • Molecular weight

      14 kDa
    • Amino acids

      1 to 125
    • Additional sequence information

      NP_004699.

Specifications

Our Abpromise guarantee covers the use of ab235622 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 90 % SDS-PAGE.
    ab235622 was expressed in E.coli and purified by using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituent: PBS

General Info

  • Alternative names

    • PDCD5
    • PDCD5_HUMAN
    • Programmed cell death protein 5
    • Protein TFAR19
    • TF 1 cell apoptosis related protein 19
    • TF-1 cell apoptosis-related protein 19
    • TFAR19
    • TFAR19 novel apoptosis-related
    see all
  • Function

    May function in the process of apoptosis.
  • Tissue specificity

    Widely expressed. Highest levels in heart, testis, kidney, pituitary gland, adrenal gland and placenta.
  • Sequence similarities

    Belongs to the PDCD5 family.
  • Developmental stage

    Expression in fetal tissues is significantly lower than in adult tissues.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab235622 (3 µg).

References

ab235622 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235622.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up