Description

  • Product name

    Recombinant human PDE10A protein
    See all PDE10A proteins and peptides
  • Biological activity

    Specific Activity: 3091 pmol/min/µg.

    One unit is defined as the amount of enzyme that will convert 1 pmole of 3',5'-cAMP to 5'- AMP per min at 37°C.

    Assay Conditions: 10 mM Tris-HCl, pH 7.4, 10 mM MgCl2, 0.05% Tween-20, 200 µM cAMP, 2.5 kU 5'-nucleotidase, and 0.25-4 ng/µl PDE10A at 37°C for 20 min. Quantified by 5'-nucleotidase cleaving the 5'-AMP product and releasing the phosphate group which is detected by Malachite Green Reagent.

  • Purity

    >= 48 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      EDGPSNNASCFRRLTECFLSPSLTDEKVKAYLSLHPQVLDEFVSESVSAE TVEKWLKRKNNKSEDESAPKEVSRYQDTNMQGVVYELNSYIEQRLDTGGD NQLLLYELSSIIKIATKADGFALYFLGECNNSLCIFTPPGIKEGKPRLIP AGPITQGTTVSAYVAKSRKTLLVEDILGDERFPRGTGLESGTRIQSVLCL PIVTAIGDLIGILELYRHWGKEAFCLSHQEVATANLAWASVAIHQVQVCR GLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQ VDHKNKELYSDLFDIGEEKEGKPVFKKTKEIRFSIEKGIAGQVARTGEVL NIPDAYADPRFNREVDLYTGYTTRNILCMPIVSRGSVIGVVQMVNKISGS AFSKTDENNFKMFAVFCALALHCANMYHRIRHSECIYRVTMEKLSYHSIC TSEEWQGLMQFTLPVRLCKEIELFHFDIGPFENMWPGIFVYMVHRSCGTS CFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAI LQNNHTLFT DLERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQT VSILQLEGHNIFSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMY QTGSLNLNNQSHRDRVIGLMMTACDLCSVTKLWPVTKLTANDIYAEFWAE GDEMKKLGIQPIPMMDRDKKDEVPQGQLGFYNAVAIPCYTTLTQILPPTE PLLKACRDNLSQWEKVIRGEETATWISSPSVAQKAAASED
    • Predicted molecular weight

      116 kDa including tags
    • Amino acids

      2 to 789
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      NM_001130690.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab198428 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol, 0.05% DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • 5''-cyclic phosphodiesterase 10A
    • cAMP and cAMP inhibited cGMP 3'5' cyclic phosphodiesterase 10A
    • cAMP and cAMP-inhibited cGMP 3''
    • FLJ11894
    • HSPDE 10A
    • HSPDE10A
    • PDE 10A
    • PDE10_HUMAN
    • Pde10a
    • Phosphodiesterase 10A
    • Phosphodiesterase 10A1
    see all
  • Function

    Plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. Can hydrolyze both cAMP and cGMP, but has higher affinity for cAMP and is more efficient with cAMP as substrate.
  • Tissue specificity

    Abundant in the putamen and caudate nucleus regions of brain and testis, moderately expressed in the thyroid gland, pituitary gland, thalamus and cerebellum.
  • Pathway

    Purine metabolism; 3',5'-cyclic AMP degradation; AMP from 3',5'-cyclic AMP: step 1/1.
    Purine metabolism; 3',5'-cyclic GMP degradation; GMP from 3',5'-cyclic GMP: step 1/1.
  • Sequence similarities

    Belongs to the cyclic nucleotide phosphodiesterase family.
    Contains 2 GAF domains.
  • Domain

    The tandem GAF domains bind cAMP, and regulate enzyme activity. The binding of cAMP stimulates enzyme activity.
    Composed of a C-terminal catalytic domain containing two divalent metal sites and an N-terminal regulatory domain which contains one cyclic nucleotide-binding region.
  • Cellular localization

    Cytoplasm. Located mostly to soluble cellular fractions.
  • Information by UniProt

Images

  • 10% SDS-PAGE Coomassie staining

    Lane 1: 2 µg ab198428

    Lane 2: Protein Marker

  • Specific activity of ab198428.

References

ab198428 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198428.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up