Description

  • Product name

    Recombinant human PDE3A protein
    See all PDE3A proteins and peptides
  • Biological activity

    Specific Activity: ≥ 4000 pmol/min/µl

  • Purity

    > 82 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      KPILAPEPLVMDNLDSIMEQLNTWNFPIFDLVENIGRKCGRILSQVSYRL FEDMGLFEAFKIPIREFMNYFHALEIGYRDIPYHNRIHATDVLHAVWYLT TQPIPGLSTVINDHGSTSDSDSDSGFTHGHMGYVFSKTYNVTDDKYGCLS GNIPALELMALYVAAAMHDYDHPGRTNAFLVATSAPQAVLYNDRSVLENH HAAAAWNLFMSRPEYNFLINLDHVEFKHFRFLVIEAILATDLKKHFDFVA KFNGKVNDDVGIDWTNENDRLLVCQMCIKLADINGPAKCKELHLQWTDGI VNEFYEQGDEEASLGLPISPFMDRSAPQLANLQESFISHIVGPLCNSYDS AGLMPGKWVEDSDESGDTDDPEEEEEEAPAPNEEETCENNESPKKKTFKR RKIYCQITQHLLQNHKMWKKVIEEEQRLAGIENQSLDQTPQSHSSEQIQA IKEEEEEKGKPRGEEIPTQKPDQ
    • Predicted molecular weight

      82 kDa including tags
    • Amino acids

      669 to 1141
    • Tags

      His tag N-Terminus , GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab198445 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.05% DTT, 20% Glycerol, 0.49% Glutathione

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • 5''-cyclic phosphodiesterase A
    • cAMP phosphodiesterase myocardial cGMP inhibited
    • CGI PDE
    • CGI PDE A
    • CGI-PDE A
    • cGMP inhibited 3' 5' cyclic phosphodiesterase A
    • cGMP-inhibited 3''
    • Cyclic GMP inhibited phosphodiesterase A
    • Cyclic GMP-inhibited phosphodiesterase A
    • Human cGMP inhibited cAMP phosphodiesterase mRNA
    • PDE 3A
    • Pde3a
    • PDE3A_HUMAN
    • Phosphodiesterase 3A
    • Phosphodiesterase 3A cGMP inhibited
    see all
  • Function

    Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes.
  • Sequence similarities

    Belongs to the cyclic nucleotide phosphodiesterase family. PDE3 subfamily.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 10% SDS-PAGE with Coomassie staining: 5 µg ab198445.

  • Example of specific activity of ab198445.

References

ab198445 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198445.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up