Description

  • Product name

    Recombinant human PDE4A protein
    See all PDE4A proteins and peptides
  • Biological activity

    Specific Activity: ≥ 11,610 pmol/min/µg

    Unit Definition: One unit is defined as the amount of enzyme that will convert 1 pmole of 3', 5'-cAMP to 5'-AMP per minute at 37°C.

    Assayed using a PDE4A Assay Kit. Assay conditions: 10 mM Tris-HCl, pH 7.4, 10 mM MgCl2, 0.1 mg/ml BSA, 0.05% Tween-20, 200 µM cAMP, 2.5 kU 5'-nucleotidase, and serial dilutions of ab198423 at 37°C for 20 min. Quantified by 5'- nucleotidase cleaving the 5' -AMP product and releasing the phosphate group which is detected by Malachite Green Reagent.

  • Purity

    40 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      EPPTVPSERSLSLSLPGPREGQATLKPPPQHLWRQPRTPIRIQQRGYSDS AERAERERQPHRPIERADAMDTSDRPGLRTTRMSWPSSFHGTGTGSGGAG GGSSRRFEAENGPTPSPGRSPLDSQASPGLVLHAGAATSQRRESFLYRSD SDYDMSPKTMSRNSSVTSEAHAEDLIVTPFAQVLASLRSVRSNFSLLTNV PVPSNKRSPLGGPTPVCKATLSEETCQQLARETLEELDWCLEQLETMQTY RSVSEMASHKFKRMLNRELTHLSEMSRSGNQVSEYISTTFLDKQNEVEIP SPTMKEREKQQAPRPRPSQPPPPPVPHLQPMSQITGLKKLMHSNSLNNSN IPRFGVKTDQEELLAQELENLNKWGLNIFCVSDYAGGRSLTCIMYMIFQE RDLLKKFRIPVDTMVTYMLTLEDHYHADVAYHNSLHAADVLQSTHVLLAT PALDAVFTDLEILAALFAAAIHDVDHPGVSNQFLINTNSELALMYNDESV LENHHLAVGFKLLQEDNCDIFQNLSKRQRQSLRKMVIDMVLATDMSKHMT LLADLKTMVETKKVTSSGVLLLDNYSDRIQVLRNMVHCADLSNPTKPLEL YRQWTDRIMAEFFQQGDRERERGMEISPMCDKHTASVEKSQVGFIDYIVH PLWETWADLVHPDAQEILDTLEDNRDWYYSAIRQSPSPPPEEESRGPGHP PLPDKFQFELTLEEEEEEEISMAQIPCTAQEALTAQGLSGVEEALDATIA WEASPAQESLEVMAQEASLEAELEAVYLTQQAQSTGSAPVAPDEFSSREE FVVAVSHSSPSALALQSPLLPAWRTLSVSEHAPGLPGLPSTAAEVEAQRE HQAAKRACSACAGTFGEDTSALPAPGGGGSGGDPT
    • Predicted molecular weight

      124 kDa including tags
    • Amino acids

      2 to 886
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      NM_001111307.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab198423 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.05% DTT, 20% Glycerol, 0.12% Glutathione

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • 5''-cyclic phosphodiesterase 4A
    • cAMP specific phosphodiesterase
    • cAMP-specific 3''
    • cAMP-specific 3',5'-cyclic phosphodiesterase 4A
    • DPDE2
    • dunce like phosphodiesterase E2
    • PDE 4A
    • PDE4
    • PDE46
    • PDE4A
    • PDE4A_HUMAN
    • PDE4A11
    • Phosphodiesterase 4A
    • phosphodiesterase 4A cAMP specific
    • Phosphodiesterase 4A, cAMP-specific (dunce
    • phosphodiesterase E2 dunce homolog
    • Phosphodiesterase E2 dunce homolog, Drosophila
    • phosphodiesterase isozyme 4
    • phosphodiesterase type 4A11
    see all
  • Function

    Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes.
  • Tissue specificity

    Isoform 1 is widely expressed. Isoform 2 is abundant in liver, stomach, testis, thyroid and adrenal glands. It is also found in placenta, kidney, pancreas, ovary, uterus, skin, monocytes, mast cells, macrophages, as well as in bronchial smooth muscle. Isoform 6 is expressed at high levels in the heart and small intestine. It is also found in the brain, kidney, spleen, colon, salivary gland, ovary and peripheral blood lymphocytes. Isoform 7 is expressed predominantly in skeletal muscle and brain and at lower levels in the testis. Isoform 7 is expressed in the brain. Found in specific neuronal subpopulations in cortex, spinal cord and cerebellum (at protein level).
  • Pathway

    Purine metabolism; 3',5'-cyclic AMP degradation; AMP from 3',5'-cyclic AMP: step 1/1.
  • Sequence similarities

    Belongs to the cyclic nucleotide phosphodiesterase family. PDE4 subfamily.
  • Post-translational
    modifications

    Phosphorylated at Ser-686 and Ser-688 when expressed in S.frugiperda cells. Isoform 2 and isoform 7 are activated by phosphorylation at Ser-119 and Ser-123 respectively by PKA.
    Proteolytically cleaved by caspase-3.
  • Cellular localization

    Cytoplasm > perinuclear region; Cytoplasm > perinuclear region. Cell projection > ruffle membrane; Cytoplasm. Membrane. Predominantly cytoplasmic and Membrane. Isoform 4 has propensity for association with membranes.
  • Information by UniProt

Images

  • 10% SDS-PAGE analysis of ab198423 (10 μg).

  • Activity assay using ab198423.

References

ab198423 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198423.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up