Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLPRNTT ISLLTTDDAMVSIDPTMPANSERTPYKVRPVAIKQLSEREELIQSVLAQV AEQFSRAFKINELKAEVANHLAVLEKRVELEGLKVVEIEKCKSDIKKMRE ELAARSSRTNCPCKYSFLDNHKKLTPRRDVPTYPKYLLSPETIEALRKPT FDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLFCVHDNYRNNP FHNFRHCFCVAQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYN NTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNIFSNIPPDGFK QIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKC CDISNEVRPMEVAEPWVDCLLEEYFMQSDREKSEGLPVAPFMDRDKVTKA TAQIGFIKFVLIPMFETVTKLFPMVEEIMLQPLWESRDRYEELKRIDDAM KELQKKTDSLTSGATEKSRERSRDVKNSEGDCA
    • Amino acids
      1 to 533
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159078 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5''-cyclic phosphodiesterase 9A
    • cGMP specific 3' 5' cyclic phosphodiesterase type 9
    • FLJ90181
    • High affinity cGMP-specific 3''
    • High-affinity cGMP-specific 3'5'-cyclic phosphodiesterase 9A
    • HSPDE9A2
    • OTTHUMP00000109399
    • PDE 9A
    • Pde9a
    • PDE9A_HUMAN
    • Phosphodiesterase 9A
    • phosphodiesterase PDE9A21
    see all
  • Function
    Hydrolyzes the second messenger cGMP, which is a key regulator of many important physiological processes.
  • Tissue specificity
    Expressed in all tissues examined (testis, brain, small intestine, skeletal muscle, heart, lung, thymus, spleen, placenta, kidney, liver, pancreas, ovary and prostate) except blood. Highest levels in brain, heart, kidney, spleen, prostate and colon. Isoform PDE9A12 is found in prostate.
  • Sequence similarities
    Belongs to the cyclic nucleotide phosphodiesterase family. PDE9 subfamily.
  • Domain
    Composed of a C-terminal catalytic domain containing two putative divalent metal sites and an N-terminal regulatory domain.
  • Cellular localization
    Cytoplasm. Endoplasmic reticulum; Cell projection > ruffle membrane. Cytoplasm > perinuclear region and Cell projection > ruffle membrane. Cytoplasm > perinuclear region. Golgi apparatus. Endoplasmic reticulum.
  • Information by UniProt

Images

  • ab159078 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159078 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159078.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up