Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      LVVTPPGPELVLNVSSTFVLTCSGSAPVVWERMSQEPPQEMAKAQDGTFS SVLTLTNLTG LDTGEYFCTHNDSRGLETDERKRLYIFVPDPTVGFLPN DAEELFIFLTEITEITIPCRVT DPQLVVTLHEKKGDVALPVPYDHQRG FSGIFEDRSYICKTTIGDREVDSDAYYVYRLQVS SINVSVNAVQTVVR QGENITLMCIVIGNEVVNFEWTYPRKESGRLVEPVTDFLLDMPYHI RS ILHIPSAELEDSGTYTCNVTESVNDHQDEKAINITVVESGYVRLLGEVGT LQFAELHR SRTLQVVFEAYPPPTVLWFKDNRTLGDSSAGEIALSTRNV SETRYVSELTLVRVKVAEAG HYTMRAFHEDAEVQLSFQLQINVPVRVL ELSESHPDSGEQTVRCRGRGMPQPNIIWSACR DLKRCPRELPPTLLGN SSEEESQLETNVTYWEEEQEFEVVSTLRLQHVDRPLSVRCTLRN AVGQ DTQEVIVVPHSLPF
    • Molecular weight

      57 kDa including tags
    • Amino acids

      33 to 530
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab155703 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Lyophilized from 0.22 µm filtered solution
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in 100 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • Beta platelet derived growth factor receptor
    • Beta-type platelet-derived growth factor receptor
    • CD 140B
    • CD140 antigen-like family member B
    • CD140b
    • CD140b antigen
    • IBGC4
    • IMF1
    • JTK12
    • OTTHUMP00000160528
    • PDGF R beta
    • PDGF Receptor beta
    • PDGF-R-beta
    • PDGFR
    • PDGFR 1
    • PDGFR beta
    • PDGFR1
    • PDGFRB
    • PGFRB_HUMAN
    • Platelet derived growth factor receptor 1
    • Platelet derived growth factor receptor beta
    • Platelet derived growth factor receptor beta polypeptide
    see all
  • Function

    Receptor that binds specifically to PDGFB and PDGFD and has a tyrosine-protein kinase activity. Phosphorylates Tyr residues at the C-terminus of PTPN11 creating a binding site for the SH2 domain of GRB2.
  • Involvement in disease

    Note=A chromosomal aberration involving PDGFRB is found in a form of chronic myelomonocytic leukemia (CMML). Translocation t(5;12)(q33;p13) with EVT6/TEL. It is characterized by abnormal clonal myeloid proliferation and by progression to acute myelogenous leukemia (AML).
    Note=A chromosomal aberration involving PDGFRB may be a cause of acute myelogenous leukemia. Translocation t(5;14)(q33;q32) with TRIP11. The fusion protein may be involved in clonal evolution of leukemia and eosinophilia.
    Note=A chromosomal aberration involving PDGFRB may be a cause of juvenile myelomonocytic leukemia. Translocation t(5;17)(q33;p11.2) with SPECC1.
    Defects in PDGFRB are a cause of myeloproliferative disorder chronic with eosinophilia (MPE) [MIM:131440]. A hematologic disorder characterized by malignant eosinophils proliferation. Note=A chromosomal aberration involving PDGFRB is found in many instances of myeloproliferative disorder chronic with eosinophilia. Translocation t(5;12) with ETV6 on chromosome 12 creating an PDGFRB-ETV6 fusion protein.
    Note=A chromosomal aberration involving PDGFRB may be the cause of a myeloproliferative disorder (MBD) associated with eosinophilia. Translocation t(1;5)(q23;q33) that forms a PDE4DIP-PDGFRB fusion protein.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
    Contains 5 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Autophosphorylated. Dephosphorylated by PTPRJ at Tyr-751, Tyr-857, Tyr-1009 and Tyr-1021.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • The purity of ab155703 was determined by SDS-PAGE of reduced ab155703 and stained overnight with Coomassie Blue.
  • Immobilized Human PDGF-BB, Tag Free at 2 μg/mL (100 μL/well) can bind Human PDGFRB, His Tag (ab155703) with a linear range of 0.039-0.625 μg/mL

References

ab155703 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab155703.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up