Description

  • Product name

    Recombinant Human PDGFRL protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ILASSNKVKSGDDISVLCTVLGEPDVEVEFTWIFPGQKDERPVTIQDTWR LIHRGLGHTTRISQSVITVEDFETIDAGYYICTAQNLQGQTTVATTVEFS
    • Amino acids

      276 to 375
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159081 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • PDGF receptor beta like tumor suppressor
    • PDGF receptor beta-like tumor suppressor
    • PDGFR-like protein
    • Pdgfrl
    • PDGRL
    • PGFRL_HUMAN
    • Platelet-derived growth factor receptor-like protein
    • PRLTS
    see all
  • Tissue specificity

    Expressed in colon, lung and liver.
  • Involvement in disease

    Colorectal cancer
    A polymorphism in PDGFRL has been reported to be associated with susceptibility to Behcet disease (PubMed:19815557). Behcet disease is a complex multiple-system disorder characterized by recurrent oral ulcerations, recurrent genital ulcerations, typical skin lesions, and uveitis. Behcet disease also involves joints, blood vessels, musculoskeletal, neurological systems, and the gastrointestinal tract.
  • Sequence similarities

    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • ab159081 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159081 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159081.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up