Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVSSQPKYDLIREVGRGSYGVVYEAVIRKTSARVAVKKIRCHAPENVELA LREFWALSSIKSQHPNVIHLEECILQKDGMVQKMSHGSNSSLYLQLVET
    • Amino acids
      1 to 99
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165589 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BC027088
    • Casein kinase
    • CLIK1L
    • EC 2.7.11.1
    • MGC36635
    • OTTHUMP00000008702
    • OTTHUMP00000008703
    • Pdik1l PDLIM1 interacting kinase 1 like
    • PDLIM1 interacting kinase 1 like
    • RGD1307476
    • RP11 96L14.4
    • Serine/threonine protein kinase PDIK1L
    • stk35l2
    see all
  • Relevance
    The specific function of PDIK1L is not yet known. It belongs to the protein kinase superfamily, Ser/Thr protein kinase family.
  • Cellular localization
    Nuclear

Images

  • ab165589 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165589 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165589.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up