Overview

  • Product name

    Recombinant Human PDILT protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      SPEVNAGVSSIHITKPVHILEERSLLVLTPAGLTQMLNQTRFLMVLFHNP SSKQSRNLAEELGKAVEIMGKGKNGIGFGKVDITIEKELQQEFGITKAPE LKLFFEGNRSEPISCKGVVESAALVVWLRRQISQKAFLFNSSEQVAEFVI SRPLVIVGFFQDLEEEVAELFYDVIKDFPELTFGVITIGNVIGRFHVTLD SVLVFKKGKIVNRQKLINDSTNKQELNRVIKQHLTDFVIEYNTENKDLIS ELHIMSHMLLFVSKSSESYGIIIQHYKLASKEFQNKILFILVDADEPRNG RVFKYFRVTEVDIPSVQILNLSSDARYKMPSDDITYESLKKFGRSFLSKN ATKHQSSEEIPKYWDQGLVKQLVGKNFNVVVFDKEKDVFVMFYAPWSKKC KMLFPLLEELGRKYQNHSTIIIAKIDVTANDIQLMYLDRYPFFRLFPSGS QQAVLYKGEHTLKGFSDFLESHIKTKIEDEDELLSVEQNEVIEEEVLAEE KEVPMMRKGLPEQQSPELENMTKYVSKLEEPAGKKKTSEEVVVVVAKPKG PPVQKKKPKVKEELVDHHHHHH
    • Molecular weight

      66 kDa including tags
    • Amino acids

      21 to 584
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152027 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. ab152027 is 0.2 µM filtered.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • 1700007B13Rik
    • PDIA7
    • Pdilt
    • PDILT_HUMAN
    • Protein disulfide isomerase family A member 7
    • Protein disulfide isomerase like testis expressed
    • Protein disulfide-isomerase-like protein of the testis
    • RGD1307822
    see all
  • Function

    Probable redox-inactive chaperone involved in spermatogenesis.
  • Tissue specificity

    Testis-specific.
  • Sequence similarities

    Belongs to the protein disulfide isomerase family.
    Contains 1 thioredoxin domain.
  • Domain

    The thioredoxin domain lacks the conserved redox-active Cys at position 417 which is replaced by a Ser residue, suggesting that it lacks thioredoxin activity.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Endoplasmic reticulum.
  • Information by UniProt

References

ab152027 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152027.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up