Recombinant Human PDK2L1 protein (ab160302)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNAVGSPEGQELQKLGSGAWDNPAYSGPPSPHGTLRVCTISSTGPLQPQP KKPEDEPQETAYRTQVSSCCLHICQGIRGLWGTTLTENTAENRELYIKTT LRELLVYIVFLVDICLLTYGMTSSSAYYYTKVMSELFLHTPSDTGVSFQA ISSMADFWDFAQGPLLDSLYWTKWYNNQSLGHGSHSFIYYENMLLGVPRL RQLKVRNDSCVVHEDFREDILSCYDVYSPDKEEQLPFGPFNGTAWTYHSQ DELGGFSHWGRLTSYSGGGYYLDLPGSRQGSAEALRALQEGLWLDRGTRV VFIDFSVYNANINLFCVLRLVVEFPATGGAIPSWQIRTVKLIRYVSNWDF FIVGCEVIFCVFIFYYVVEEILELHIHRLRYLSSIWNILDLVVILLSIVA VGFHIFRTLEVNRLMGKLLQQPNTYADFEFLAFWQTQYNNMNAVNLFFAW IKIFKYISFNKTMTQLSSTLARCAKDILGFAVMFFIVFFAYAQLGYLLFG TQVENFSTFIKCIFTQFRIILGDFDYNAIDNANRILGPAYFVTYVFFVFF VLLNMFLAIINDTYSEVKEELAGQKDELQLSDLLKQGYNKTLLRLRLRKE RVSDVQKVLQGGEQEIQFEDFTNTLRELGHAEHEITELTATFTKFDRDGN RILDEKEQEKMRQDLEEERVALNTEIEKLGRSIVSSPQGKSGPEAARAGG WVSGEEFYMLTRRVLQLETVLEGVVSQIDAVGSKLKMLERKGWLAPSPGV KEQAIWKHPQPAPAVTPDPWGVQGGQESEVPYKREEEALEERRLSRGEIP TLQRS
    • Amino acids
      1 to 805
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160302 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • B830002B15
    • BC046386
    • PCL
    • PK2L1
    • PK2L1_HUMAN
    • PKD2L
    • PKD2L1
    • PKDL
    • Polycystic kidney disease 2 like 1
    • Polycystic kidney disease 2 like 1 protein
    • Polycystic kidney disease 2-like 1 protein
    • Polycystin L
    • Polycystin-2 homolog
    • Polycystin-2L1
    • Polycystin-L
    • Polycystin-L1
    • Transient receptor potential cation channel subfamily P member 3
    • TRPP3
    see all
  • Function
    May function as a subunit of an ion channel and act as a transducer of calcium-mediated signaling.
  • Tissue specificity
    Expressed in adult heart, skeletal muscle, brain, spleen, testis, retina and liver. According to PubMed:9748274, expressed at high levels in fetal tissues, including kidney and liver, and down-regulated in adult tissues. According to PubMed:10602361, expressed in fetal brain, but not expressed in fetal lung, liver or kidney. Isoform 4 appears to be expressed only in transformed lymphoblasts.
  • Sequence similarities
    Belongs to the polycystin family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab160302 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160302 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160302.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up