Overview

  • Product name

    Recombinant Human PDLIM2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MALTVDVAGPAPWGFRITGGRDFHTPIMVTKVAERGKAKDADLRPGDIIV AINGESAEGMLHAEAQSKIRQSPSPLRLQLDRSQATSPGQTNGDSSLEVL ATRFQGSVRTYTESQSSLRSSYSSPTSLSPRAGSPFSPPPSSSSLTGEAA ISRSFQSLACSPGLPAADRLSYSGRPGSRQAGLGRAGDSAVLVLPPSPGP RSSRPSMDSEGGSLLLDEDSEVFKMLQENREGRAAPRQSSSFRLLQEALE AEERGGTPAFLPSSLSPQSSLPASRALATPPKLHTCEKCSTSIANQAVRI QEGRYRHPGCYTCADCGLNLKMRGHFWVGDELYCEKHARQRYSAPATLSS RA
    • Molecular weight

      64 kDa including tags
    • Amino acids

      1 to 352

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132767 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ34715
    • MYSTIQUE
    • OTTHUMP00000162522
    • OTTHUMP00000205197
    • OTTHUMP00000205198
    • OTTHUMP00000205199
    • OTTHUMP00000205200
    • OTTHUMP00000205202
    • OTTHUMP00000205203
    • PDLI2_HUMAN
    • Pdlim2
    • PDZ and LIM domain 2 (mystique)
    • PDZ and LIM domain protein 2
    • PDZ-LIM protein mystique
    • SLIM
    • Stat-interacting LIM protein
    see all
  • Function

    Probable adapter protein located at the actin cytoskeleton that promotes cell attachment. Necessary for the migratory capacity of epithelial cells. Overexpression enhances cell adhesion to collagen and fibronectin and suppresses anchorage independent growth. May contribute to tumor cell migratory capacity.
  • Sequence similarities

    Contains 1 LIM zinc-binding domain.
    Contains 1 PDZ (DHR) domain.
  • Cellular localization

    Cytoplasm > cytoskeleton; Nucleus; Cytoplasm. Nucleus. May be partially nuclear and Cytoplasm > cytoskeleton. Colocalizes with beta-1 integrin (ITGB1) and alpha-actinin but not with paxillin.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132767 stained with Coomassie Blue.

References

ab132767 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132767.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up