Overview

  • Product name
    Recombinant Human PDLIM7 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDSFKVVLEGPAPWGFRLQGGKDFNVPLSISRLTPGGKAAQAGVAVGDWV LSIDGENAGSLTHIEAQNKIRACGERLSLGLSRAQPVQSKPQKASAPAAD PPRYTFAPSVSLNKTARPFGAPPPADSAPQQNGQPLRPLVPDASKQRLME NTEDWRPRPGTGQSRSFRILAHLTGTEFMQDPDEEHLKKSSQVPRTEAPA PASSTPQEPWPGPTAPSPTSRPPWAVDPAFAERYAPDKTSTVLTRHSQPA TPTPLQSRTSIVQAAAGGVPGGGSNNGKTPVCHQCHKVIRGRYLVALGHA YHPEEFVCSQCGKVLEEGGFFEEKGAIFCPPCYDVRYAPSCAKCKKKITG EIMHALKMTWHVHCFTCAACKTPIRNRAFYMEEGVPYCERDYEKMFGTKC HGCDFKIDAGDRFLEALGFSWHDTCFVCAICQINLEGKTFYSKKDRPLCK SHAFSHV
    • Amino acids
      1 to 457
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160403 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1110003B01Rik
    • Enigma
    • LIM domain protein
    • LIM domain protein enigma
    • LIM mineralization protein
    • LIM mineralization protein 1
    • Lim mineralization protein 3
    • LMP
    • LMP 1
    • LMP1
    • LMP3
    • PDLI7_HUMAN
    • PDLIM 7
    • Pdlim7
    • PDZ and LIM doamin protein 7
    • PDZ and LIM domain 7
    • PDZ and LIM domain protein 7
    • Protein enigma
    see all
  • Function
    May function as a scaffold on which the coordinated assembly of proteins can occur. May play a role as an adapter that, via its PDZ domain, localizes LIM-binding proteins to actin filaments of both skeletal muscle and nonmuscle tissues. Involved in both of the two fundamental mechanisms of bone formation, direct bone formation (e.g. embryonic flat bones mandible and cranium), and endochondral bone formation (e.g. embryonic long bone development). Plays a role during fracture repair. Involved in BMP6 signaling pathway.
  • Tissue specificity
    Isoform 1 and isoform 2 are expressed ubiquitously, however, isoform 2 predominates in skeletal muscle, isoform 1 is more abundant in lung, spleen, leukocytes and fetal liver.
  • Sequence similarities
    Contains 3 LIM zinc-binding domains.
    Contains 1 PDZ (DHR) domain.
  • Domain
    The LIM zinc-binding 2 (LIM 2) domain interacts with TBX4.
    The LIM zinc-binding 3 (LIM 3) domain provides the structural basis for recognition of tyrosine-containing tight turn structures. This domain is necessary and sufficient for interaction with TBX5.
    Anchored to cell periphery via its N-terminal PDZ domain.
  • Cellular localization
    Cytoplasm. Cytoplasm > cytoskeleton. Colocalizes with RET to the cell periphery and in some cytoskeletal components. Colocalizes with TPM2 near the Z line in muscle. Co-localizes with TBX4 and TBX5 to actin filaments.
  • Information by UniProt

Images

  • ab160403 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160403 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160403.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up