For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-pdx1-protein-ab114175.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Growth Factors/Hormones Insulin / Insulin-like
Share by email

Recombinant Human PDX1 protein (ab114175)

  • Datasheet
Submit a review Q&A (2)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human PDX1 protein (ab114175)

    Key features and details

    • Expression system: Wheat germ
    • Suitable for: SDS-PAGE, WB, ELISA

    Description

    • Product name

      Recombinant Human PDX1 protein
    • Expression system

      Wheat germ
    • Accession

      P52945
    • Protein length

      Full length protein
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Human
      • Sequence

        MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPF PGALGALEQGSPPDISPYEVPPLADDPAVAHLHHHLPAQLALPHPPAGPF PEGAEPGVLEEPNRVQLPFPWMKSTKAHAWKGQWAGGAYAAEPEENKRTR TAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMK WKKEEDKKRGGGTAVGGGGVAEPEQDCAVTSGEELLALPPPPPPGGAVPP AAPVAAREGRLPPGLSASPQPSSVAPRRPQEPR
      • Predicted molecular weight

        58 kDa including tags
      • Amino acids

        1 to 283

    Associated products

    • Related Products

      • Anti-PDX1 antibody [OTI2A12] (ab84987)
      • Anti-PDX1 antibody (ab98298)

    Specifications

    Our Abpromise guarantee covers the use of ab114175 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      SDS-PAGE

      Western blot

      ELISA

    • Form

      Liquid
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

      pH: 8.00
      Constituents: 0.3% Glutathione, 0.79% Tris HCl

    General Info

    • Alternative names

      • Glucose sensitive factor
      • Glucose-sensitive factor
      • GSF
      • IDX 1
      • IDX-1
      • IDX1
      • Insulin promoter factor 1
      • Insulin promoter factor 1 homeodomain transcription factor
      • Insulin upstream factor 1
      • IPF 1
      • IPF-1
      • IPF1
      • Islet/duodenum homeobox 1
      • Islet/duodenum homeobox-1
      • IUF 1
      • IUF-1
      • IUF1
      • MODY4
      • Pancreas/duodenum homeobox 1
      • Pancreas/duodenum homeobox protein 1
      • pancreatic and duodenal homeobox P
      • PDX 1
      • PDX-1
      • PDX1
      • PDX1_HUMAN
      • Somatostatin transactivating factor 1
      • Somatostatin-transactivating factor 1
      • STF 1
      • STF-1
      • STF1
      see all
    • Function

      Activates insulin, somatostatin, glucokinase, islet amyloid polypeptide and glucose transporter type 2 gene transcription. Particularly involved in glucose-dependent regulation of insulin gene transcription. Binds preferentially the DNA motif 5'-[CT]TAAT[TG]-3'. During development, specifies the early pancreatic epithelium, permitting its proliferation, branching and subsequent differentiation. At adult stage, required for maintaining the hormone-producing phenotype of the beta-cell.
    • Tissue specificity

      Duodenum and pancreas (Langerhans islet beta cells and small subsets of endocrine non-beta-cells, at low levels in acinar cells).
    • Involvement in disease

      Defects in PDX1 are a cause of pancreatic agenesis (PAC) [MIM:260370]. This autosomal recessive disorder is characterized by absence or hypoplasia of pancreas, leading to early-onset insulin-dependent diabetes mellitus. This was found in a frameshift mutation that produces a truncated protein and results in a second initiation that produces a second protein that act as a dominant negative mutant.
      Defects in PDX1 are a cause of non-insulin-dependent diabetes mellitus (NIDDM) [MIM:125853]; also known as diabetes mellitus type 2. NIDDM is characterized by an autosomal dominant mode of inheritance, onset during adulthood and insulin resistance.
      Defects in PDX1 are the cause of maturity-onset diabetes of the young type 4 (MODY4) [MIM:606392]; also symbolized MODY-4. MODY is a form of diabetes that is characterized by an autosomal dominant mode of inheritance, onset in childhood or early adulthood (usually before 25 years of age), a primary defect in insulin secretion and frequent insulin-independence at the beginning of the disease.
    • Sequence similarities

      Belongs to the Antp homeobox family. IPF1/XlHbox-8 subfamily.
      Contains 1 homeobox DNA-binding domain.
    • Domain

      The Antp-type hexapeptide mediates heterodimerization with PBX on a regulatory element of the somatostatin promoter.
      The homeodomain, which contains the nuclear localization signal, not only mediates DNA-binding, but also acts as a protein-protein interaction domain for TCF3(E47), NEUROD1 and HMG-I(Y).
    • Post-translational
      modifications

      Phosphorylated by the SAPK2 pathway at high intracellular glucose concentration.
    • Cellular localization

      Nucleus.
    • Target information above from: UniProt accession P52945 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • SDS-PAGE - Recombinant Human PDX1 protein (ab114175)
      SDS-PAGE - Recombinant Human PDX1 protein (ab114175)
      ab114175 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab114175? Please let us know so that we can cite the reference in this datasheet.

    ab114175 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    1-2 of 2 Abreviews or Q&A

    Question

    Yes, these answers are of help.
    I will test the protein using an electrophoretic mobility assay for
    its affinity to its known DNA binding sequence. I must admit though
    that I do not have a positive control because I do not have known
    active pdx-1 currently available to me. If the test result is of use
    to you despite the absence of a positive control, I am willing to
    share the data obtained and participate in the test program.

    Read More

    Abcam community

    Verified customer

    Asked on May 14 2012

    Answer

    Yes, you can submit an Abreview for EMSA. Please select "Other" in the application field, and also please submit as much information as you are able to provide.

    DISCOUNT CODE: xxx
    Expiration date: xxx

    I am very pleased to hear you would like to accept our offer and test ab114175 in EMSA. This code will give you: 1 freePROTEINbefore the expiration date. To redeem this offer, please submit an Abreview for EMSAand include this code in the “Additional Comments” section so we know the Abreview is for this promotion. For more information on how to submit an Abreview, please visit the site: www.abcam.com/Abreviews.

    Remember, we publish both positive and negative Abreviews on our datasheets so please submit the results of your tests. The code will be active once the Abreview has been submitted and can be redeemed in one of the following ways: 1) Call to place your order and mention the code to our customer service department; 2) Include the code in your fax order; 3) Place your order on the web and enter the promotional code.

    Any feedback that you can provide will be greatly appreciated, whether positive or negative. If you have any further questions, please do not hesitate to contact us. We look forward to receiving your Abreview and wish you luck with your research.

    The terms and conditions applicable to this offer can be found here: https://www.abcam.com/collaborationdiscount.

    Read More

    Abcam Scientific Support

    Answered on May 14 2012

    Question

    1. Is protein biologally active?
    2. Is there a method to remove the tag afterwards?

    Read More

    Abcam community

    Verified customer

    Asked on May 10 2012

    Answer

    Thank you for contacting us.

    The lab sent me the following answers:

    1. Is the protein biologally active? Has this been tested?

    Answer: We have not tested the recombinant proteins for activity assay yet so we do not know if the proteins are active or functional.

    2. Do you know of a method to remove the GST-tag?

    Answer: The GST tag is at the N-terminal end and it could be cleavaged from the fusion protein by PreScission Protease.

    If you like to try the protein in functional/activity studies, we have a testing discount program you are eligible for in this case.

    For UNTESTED species and/or applications, we have established a testing discount program. Here is a brief description of how it works:

    The testing discount program is for customers who like to use an antibody/protein/kit on an untested species/application. You would purchase the antibody/protein/kit at full price, test it and submit an Abreview with your data (positive or negative). On your next order you will receive a discount for ONE antibody/protein at the full price (100%) of the antibody/protein you have tested, or a full price discount for the amount paid for the kit. The terms and conditions applicable to this offer can be found here: https://www.abcam.com/collaborationdiscount.
    This programapplies to ELISA kits and other kits we offer.

    Please let me know if I shall send you a testing discount code.

    I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

    Use our products? Submit an Abreview. Earn rewards!
    https://www.abcam.com/abreviews

    Read More

    Abcam Scientific Support

    Answered on May 10 2012

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.