Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MDASLEKIADPTLAEMGKNLKEAVKMLEDSQRRTEEENGKKLISGDIPGP LQGSGQDMVSILQLVQNLMHGDEDEEPQSPRIQNIGEQGHMALLGHSLGA YISTLDKEKLRKLTTRILSDTTLWLCRIFRYENGCAYFHEEEREGLAKIC RLAIHSRYEDFVVDGFNVLYNKKPVIYLSAAARPGLGQYLCNQLGLPFPC LCRVPCNTVFGSQHQMDVAFLEKLIKDDIERGRLPLLLVANAGTAAVGHT DKIGRLKELCEQYGIWLHVEGVNLATLALGYVSSSVLAAAKCDSMTMTPG PWLGLPAVPAVTLYKHDDPALTLVAGLTSNKPTDKLRALPLWLSLQYLGL DGFVERIKHACQLSQRLQESLKEVNYIKILVEDELSSPVVVFRFFQELPG SDPVFKAVPVPNMTPSGVGRERHSCDALNRWLGEQLKQLVPASGLTVMDL EAEGTCLRFSPLMTAAVLGTRGEDVDQLVACIESKLPVLCCTLQLREEFK QEVEATAGLLYVDDPNWSGIGVVRYEHANDDKSSLKSDPEGENIHAGLLK KLNELESDLTFKIGPEYKSMKSCLYVGMASDNVDAAELVETIAATAREIE ENSRLLENMTEVVRKGIQEAQVELQKASEERLLEEGVLRQIPVVGSVLNW FSPVQALQKGRTFNLTAGSLESTEPIYVYKAQGAGVTLPPTPSGSRTKQR LPGQKPFKRSLRGSDALSETSSVSHIEDLEKVERLSSGPEQITLEASSTE GHPGAPSPQHTDQTEAFQKGVPHPEDDHSQVEGPESLR
    • Molecular weight

      113 kDa including tags
    • Amino acids

      1 to 788

Specifications

Our Abpromise guarantee covers the use of ab132779 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 2210010A19Rik
    • AA415817
    • KIAA0251
    • Kiaa0251 hp
    • LP8165
    • MGC189517
    • MGC8182
    • PDXD1_HUMAN
    • PDXDC 1
    • Pdxdc1
    • Pyridoxal dependent decarboxylase domain containing 1
    • Pyridoxal-dependent decarboxylase domain-containing protein 1
    • rCG_49895
    • RGD1562597
    see all
  • Sequence similarities

    Belongs to the group II decarboxylase family.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132779, stained with Coomassie Blue.

References

ab132779 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132779.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up