Description

  • Product name

    Recombinant Human PEA15 protein
    See all PEA15 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab172828 is greater than 95% pure, as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GSHMAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFS FLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDT KLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA
    • Predicted molecular weight

      15 kDa
    • Amino acids

      1 to 130

Specifications

Our Abpromise guarantee covers the use of ab172828 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Supplied as a 0.2 µM filtered solution

General Info

  • Alternative names

    • 15 kDa phosphoprotein enriched in astrocytes
    • Astrocytic phosphoprotein PEA 15
    • Astrocytic phosphoprotein PEA-15
    • Astrocytic phosphoprotein PEA15
    • HMAT 1
    • HMAT1
    • Homolog of mouse MAT 1 oncogene
    • Homolog of mouse MAT1 oncogene
    • HUMMAT 1H
    • HUMMAT1H
    • MAT 1
    • MAT 1H
    • MAT1
    • MAT1H
    • PEA 15
    • Pea15
    • PEA15 protein
    • PEA15_HUMAN
    • PED
    • Phosphoprotein enriched in astrocytes 15
    • Phosphoprotein enriched in astrocytes 15kD
    • Phosphoprotein enriched in diabetes
    see all
  • Function

    Blocks Ras-mediated inhibition of integrin activation and modulates the ERK MAP kinase cascade. Inhibits RPS6KA3 activities by retaining it in the cytoplasm (By similarity). Inhibits both TNFRSF6- and TNFRSF1A-mediated CASP8 activity and apoptosis. Regulates glucose transport by controlling both the content of SLC2A1 glucose transporters on the plasma membrane and the insulin-dependent trafficking of SLC2A4 from the cell interior to the surface.
  • Tissue specificity

    Ubiquitously expressed. Most abundant in tissues such as heart, brain, muscle and adipose tissue which utilize glucose as an energy source. Lower expression in glucose-producing tissues. Higher levels of expression are found in tissues from individuals with type 2 diabetes than in controls.
  • Sequence similarities

    Contains 1 DED (death effector) domain.
  • Post-translational
    modifications

    Phosphorylated by protein kinase C and calcium-calmodulin-dependent protein kinase. These phosphorylation events are modulated by neurotransmitters or hormones.
  • Cellular localization

    Cytoplasm. Associated with microtubules.
  • Information by UniProt

References

ab172828 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172828.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up