Overview

  • Product name

    Recombinant Human PEG10/EDR protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MTERRRDELSEEINNLREKVMKQSEENNNLQSQVQKLTEENTTLREQVEP TPEDEDDDIELRGAAAAAAPPPPIEEECPEDLPEKFDGNPDMLAPFMAQC QIFMEKSTRDFSVDRVRVCFVTSMMTGRAARWASAKLERSHYLMHNYPAF MMEMKHVFEDPQRREVAKRKIRRLRQGMGSVIDYSNAFQMIAQDLDWNEP ALIDQYHEGLSDHIQEELSHLEVAKSLSALIGQCIHIERRLARAAAARKP RSPPRALVLPHIASHHQVDPTEPVGGARMRLTQEEKERRRKLNLCLYCGT GGHYADNCPAKASKSSPAGNSPAPL
    • Amino acids

      1 to 325
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161530 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as PEG10

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AA407948
    • Edr
    • Embryonal carcinoma differentiation regulated
    • Embryonal carcinoma differentiation-regulated protein
    • HB 1
    • HB1
    • KIAA1051
    • Mammalian retrotransposon-derived protein 2
    • Mar2
    • Mart2
    • MEF3 like 1
    • MEF3-like protein 1
    • MEF3L
    • MEF3L1
    • MyEF 3
    • Myelin expression factor 3-like protein 1
    • Paternally expressed 10
    • Paternally expressed gene 10 ORF1
    • Paternally expressed gene 10 protein
    • Peg10
    • PEG10 protein
    • PEG10_HUMAN
    • Putative uncharacterized protein PEG10
    • Retrotransposon gag domain containing 3
    • Retrotransposon gag domain-containing protein 3
    • Retrotransposon-derived gag-like polyprotein
    • Retrotransposon-derived protein PEG10
    • RGAG3
    • Ty3/Gypsy-like protein
    see all
  • Function

    Prevents apoptosis in hepatocellular carcinoma (HCC) cells through interaction with SIAH1, a mediator of apoptosis. May also have a role in cell growth promotion and hepatoma formation. Inhibits the TGF-beta signaling by interacting with the TGF-beta receptor ALK1. When overexpressed, induces the formation of cellular extension, such as filipodia in association with ALK1. Involved at the immediate early stage of adipocyte differentiation (By similarity). May bind to the 5'-GCCTGTCTTT-3' DNA sequence of the MB1 domain in the myelin basic protein (MBP) promoter.
  • Tissue specificity

    Expressed in the cytotrophoblast layer but not in the overlying syncytiotrophoblast of the placenta. Expressed in prostate and breast carcinomas but not in normal breast and prostate epithelial cells. Expressed in the HepG2 cell line (at protein level). Expressed in brain, liver, spleen, kidney, thymus, lung, ovary, testis, reactive lymph node, skeletal muscle, adipose tissue and placenta. Expressed in pancreatic and hepatocellular carcinomas (HCC).
  • Sequence similarities

    Contains 1 CCHC-type zinc finger.
  • Developmental stage

    Expressed in placenta during the first trimester of gestation (at protein level). In placenta, down-regulated at early hypoxic phase, and highly activated at 11-12 week of gestation.
  • Post-translational
    modifications

    Isoform RF1/RF2 undergoes proteolytic cleavage.
  • Cellular localization

    Nucleus. Cytoplasm. Detected predominantly in the cytoplasm of breast and prostate carcinomas, in hepatocellular carcinoma (HCC) and B-cell chronic lymphocytic leukemia (B-CLL) cells and in the HepG2 cell line. Colocalized with ALK1.
  • Information by UniProt

Images

  • ab161530 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161530 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161530.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up