Recombinant Human PEG10/EDR protein (ab161530)
- Datasheet
- References
- Protocols
Overview
-
Product nameRecombinant Human PEG10/EDR protein
-
Protein lengthFull length protein
Description
-
NatureRecombinant
-
SourceWheat germ
-
Amino Acid Sequence
-
SpeciesHuman
-
SequenceMTERRRDELSEEINNLREKVMKQSEENNNLQSQVQKLTEENTTLREQVEP TPEDEDDDIELRGAAAAAAPPPPIEEECPEDLPEKFDGNPDMLAPFMAQC QIFMEKSTRDFSVDRVRVCFVTSMMTGRAARWASAKLERSHYLMHNYPAF MMEMKHVFEDPQRREVAKRKIRRLRQGMGSVIDYSNAFQMIAQDLDWNEP ALIDQYHEGLSDHIQEELSHLEVAKSLSALIGQCIHIERRLARAAAARKP RSPPRALVLPHIASHHQVDPTEPVGGARMRLTQEEKERRRKLNLCLYCGT GGHYADNCPAKASKSSPAGNSPAPL
-
Amino acids1 to 325
-
TagsGST tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab161530 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
Western blot
-
FormLiquid
-
Additional notesProtein concentration is above or equal to 0.05 mg/ml.
This product was previously labelled as PEG10
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- AA407948
- Edr
- Embryonal carcinoma differentiation regulated
see all -
FunctionPrevents apoptosis in hepatocellular carcinoma (HCC) cells through interaction with SIAH1, a mediator of apoptosis. May also have a role in cell growth promotion and hepatoma formation. Inhibits the TGF-beta signaling by interacting with the TGF-beta receptor ALK1. When overexpressed, induces the formation of cellular extension, such as filipodia in association with ALK1. Involved at the immediate early stage of adipocyte differentiation (By similarity). May bind to the 5'-GCCTGTCTTT-3' DNA sequence of the MB1 domain in the myelin basic protein (MBP) promoter.
-
Tissue specificityExpressed in the cytotrophoblast layer but not in the overlying syncytiotrophoblast of the placenta. Expressed in prostate and breast carcinomas but not in normal breast and prostate epithelial cells. Expressed in the HepG2 cell line (at protein level). Expressed in brain, liver, spleen, kidney, thymus, lung, ovary, testis, reactive lymph node, skeletal muscle, adipose tissue and placenta. Expressed in pancreatic and hepatocellular carcinomas (HCC).
-
Sequence similaritiesContains 1 CCHC-type zinc finger.
-
Developmental stageExpressed in placenta during the first trimester of gestation (at protein level). In placenta, down-regulated at early hypoxic phase, and highly activated at 11-12 week of gestation.
-
Post-translational
modificationsIsoform RF1/RF2 undergoes proteolytic cleavage. -
Cellular localizationNucleus. Cytoplasm. Detected predominantly in the cytoplasm of breast and prostate carcinomas, in hepatocellular carcinoma (HCC) and B-cell chronic lymphocytic leukemia (B-CLL) cells and in the HepG2 cell line. Colocalized with ALK1.
- Information by UniProt
Images
-
SDS-PAGE - Recombinant Human PEG10/EDR protein (ab161530)ab161530 on a 12.5% SDS-PAGE stained with Coomassie Blue.
Datasheets and documents
References
ab161530 has not yet been referenced specifically in any publications.
