Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MFSPGQEEHCAPNKEPVKYGELVVLGYNGALPNGDRGRRKSRFALYKRPK ANGVKPSTVHVISTPQASKAISCKGQHSISYTLSRNQTVVVEYTHDKDTD MFQVGRSTESPIDFVVTDTISGSQNTDEAQITQSTISRFACRIVCDRNEP YTARIFAAGFDSSKNIFLGEKAAKWKNPDGHMDGLTTNGVLVMHPRGGFT EESQPGVWREISVCGDVYTLRETRSAQQRGKLVESETNVLQDGSLIDLCG ATLLWRTADGLFHTPTQKHIEALRQEINAARPQCPVGLNTLAFPSINRKE VVEEKQPWAYLSCGHVHGYHNWGHRSDTEANERECPMCRTVGPYVPLWLG CEAGFYVDAGPPTHAFTPCGHVCSEKSAKYWSQIPLPHGTHAFHAACPFC ATQLVGEQNCIKLIFQGPID
    • Amino acids
      1 to 420
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163508 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E3 ubiquitin-protein ligase pellino homolog 2
    • PELI2
    • pellino E3 ubiquitin protein ligase family member 2
    • Pellino homolog 2
  • Relevance
    Scaffold protein which probably links Toll like receptors (TLRs) to basic cellular processes via its interaction with the complex containing IRAK (IL1R associated kinase) kinases and TRAF6. Can activate the MAP (mitogen activated protein) kinase pathway leading to activation of ELK1. Not required for NF-kappa-B activation.

Images

  • ab163508 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163508 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163508.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up