Description

  • Product name

    Recombinant Human Pellino-3 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MVLEGNPEVGSPRTSDLQHRGNKGSCVLSSPGEDAQPGEEPIKYGELIVL GCCEEGGEETEAQRGEVTGPRAHSCYNGCLASGDKGRRRSRLALSRRSHA NGVKPDVMHHISTPLVSKALSNRGQHSISYTLSRSHSVIVEYTHDSDTDM FQIGRSTENMIDFVVTDTSPGGGAAEGPSAQSTISRYACRILCDRRPPYT ARIYAAGFDASSNIFLGERAAKWRTPDGLMDGLTTNGVLVMHPAGGFSED SAPGVWREISVCGNVYTLRDSRSAQQRGKLVGGPLHSPPLSLPGPHKLPI PLPKPGDDLQSFCPREPQQAPYQGIPGPGGS
    • Predicted molecular weight

      62 kDa including tags
    • Amino acids

      1 to 331

Specifications

Our Abpromise guarantee covers the use of ab132822 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

    Previously labelled as PELI3.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • E3 ubiquitin protein ligase pellino homolog 3
    • MGC35521
    • PEL 13
    • Peli3
    • PELI3_HUMAN
    • Pellino 3
    • Pellino 3 alpha
    • Pellino E3 ubiquitin protein ligase family member 3
    • Pellino homolog 3 (Drosophila)
    • Pellino-3
    • Protein pellino homolog 3
    see all
  • Function

    Scaffold protein which probably links Toll-like receptors (TLRs) to basic cellular processes via its interaction with the complex containing IRAK kinases and TRAF6. Can activate AP1/JUN and ELK1. Not required for NF-kappa-B activation. Probably involved in innate immune response.
  • Tissue specificity

    Highly expressed in brain, heart and testis, and at lower level in kidney, liver, lung, placenta, small intestine, spleen and stomach. Isoform 1 is not expressed in lung.
  • Sequence similarities

    Belongs to the pellino family.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132822 stained with Coomassie Blue.

References

ab132822 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132822.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up