Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MKLVRKNIEKDNAGQVTLVPEEPEDMWHTYNLVQVGDSLRASTIRKVQTE SSTGSVGSNRVRTTLTLCVEAIDFDSQACQLRVKGTNIQENEYVKMGAYH TIELEPNRQFTLAKKQWDSVVLERIEQACDPAWSADVAAVVMQEGLAHIC LVTPSMTLTRAKVEVNIPRKRKGNCSQHDRALERFYEQVVQAIQRHIHFD VVKCILVASPGFVREQFCDYMFQQAVKTDNKLLLENRSKFLQVHASSGHK YSLKEALCDPTVASRLSDTKAAGEVKALDDFYKMLQHEPDRAFYGLKQVE KANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLH VSGEQLSQLTGVAAILRFPVPELSDQEGDSSSEED
    • Molecular weight

      70 kDa including tags
    • Amino acids

      1 to 385

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132891 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 ug/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CGI 17
    • CGI17
    • pelo
    • PELO_HUMAN
    • pelota (Drosophila) homolog
    • pelota homolog
    • PRO1770
    • Protein pelota homolog
    see all
  • Function

    Required for normal chromosome segregation during cell division and genomic stability (By similarity). May function in recognizing stalled ribosomes and triggering endonucleolytic cleavage of the mRNA, a mechanism to release non-functional ribosomes and degrade damaged mRNAs. May have ribonuclease activity.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Belongs to the eukaryotic release factor 1 family. Pelota subfamily.
  • Domain

    The N-terminal domain has the RNA-binding Sm fold. It may harbor the endoribonuclease activity.
  • Cellular localization

    Nucleus. Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132891 stained with Coomassie Blue.

References

ab132891 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132891.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up