Description

  • Product name

    Recombinant Human PEN2 protein
    See all PEN2 proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQ SQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGT P
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      1 to 101

Specifications

Our Abpromise guarantee covers the use of ab132019 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Gamma secretase subunit PEN 2
    • Gamma Secretase Subunit PEN2
    • Gamma-secretase subunit PEN-2
    • Hematopoietic stem/progenitor cells protein MDS033
    • MDS033
    • MSTP064
    • PEN 2
    • PEN2_HUMAN
    • Presenilin Enhancer 2
    • Presenilin enhancer 2 homolog
    • Presenilin enhancer protein 2
    • PSEN2
    • psenen
    see all
  • Function

    Essential subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (beta-amyloid precursor protein). Probably represents the last step of maturation of gamma-secretase, facilitating endoproteolysis of presenilin and conferring gamma-secretase activity.
  • Tissue specificity

    Widely expressed. Expressed in leukocytes, lung, placenta, small intestine, liver, kidney, spleen thymus, skeletal muscle, heart and brain.
  • Sequence similarities

    Belongs to the PEN-2 family.
  • Cellular localization

    Endoplasmic reticulum membrane. Golgi apparatus > Golgi stack membrane. Predominantly located in the endoplasmic reticulum and in the cis-Golgi.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab132019 at approximately 36.85 kDa.

References

ab132019 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132019.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up