Overview

  • Product name
    Recombinant Human Penicillin Binding Protein 2X
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      TGTRFGTDLAKEAKKVHQTTRTVPAKRGTIYDRNGVPIAEDATSYNVYAV IDENYKSATGKILYVEKTQFNKVAEVFHKYLDMEESYVREQLSQPNLKQV SFGAKGNGITYANMMSIKKELEAAEVKGIDFTTSPNRSYPNGQFASSFIG LAQLHENEDGSKSLLGTSGMESSLNSILAGTDGIITYEKDRLGNIVPGTE QVSQRTMDGKDVYTTISSPLQSFMETQMDAFQEKVKGKYMTATLVSAKTG EILATTQRPTFDADTKEGITEDFVWRDILYQSNYEPGSTMKVMMLAAAID NNTFPGGEVFNSSELKIADATIRDWDVNEGLTGGRMMTFSQGFAHSSNVG MTLLEQKMGDATWLDYLNRFKFGVPTRFGLTDEYAGQLPADNIVNIAQSS FGQGISVTQTQMIRAFTAIANDGVMLEPKFISAIYDPNDQTARKSQKEIV GNPVSKDAASLTRTNMVLVGTDPVYGTMYNHSTGKPTVTVPGQNVALKSG TAQIADEKNGGYLVGLTDYIFSAVSMSPAENPDFILYVTVQQPEHYSGIQ LGEFANPILERASAMKDSLNLQTTAKALEQVSQQSPYPMPSVKDISPGDL AEELRRNLVQPIVVGTGTKIKNSSAEEGKNLAPNQQVLILSDKAEEVPDM YGWTKETAETLAKWLNIELEFQGSGSTVQKQDVRANTAIKDIKKITLTLG D
    • Molecular weight
      77 kDa
    • Amino acids
      50 to 750
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab168007 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: PBS, 50% Glycerol

General Info

  • Alternative names
    • PBP-2X
    • PBP2X
    • pbpX
    • PBPX_STRR6
    • Penicillin-binding protein 2X
    see all
  • Function
    Penicillin-binding proteins (PBPs) function in the late steps of murein biosynthesis. Beta-lactams inactivate the PBPs by acylating an essential serine residue in the active site of these proteins.
  • Sequence similarities
    Belongs to the transpeptidase family.
    Contains 2 PASTA domains.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab168007.

References

ab168007 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab168007.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up