Overview

  • Product name
    Recombinant Human Pepsin protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      WNQGLVSQDLFSVYLSADDKSGSVVIFGGIDSSYYTGSLNWVPVTVEGYW QITVDSITMNGETIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASEN SDGD
    • Amino acids
      203 to 306
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159101 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Pepsin
    • Pepsin A
    • Pepsin A 3
    • Pepsin A 4
    • Pepsin A 5
    • Pepsinogen
    • Pepsinogen 3
    • Pepsinogen 4
    • Pepsinogen 5
    • PGA
    • PGA3
    • PGA4
    • PGA5
    see all
  • Relevance
    Pepsin is a digestive enzyme with particularly broad specificity. It is stored as pepsinogen, so only released when needed. In the stomach, chief cells release pepsinogen. The hormone gastrin and the vagus nerve trigger the release of both pepsinogen and HCl from the stomach lining when food is ingested. HCl creates an acidic environment which allows pepsinogen to unfold and cleave itself in an autocatalytic fashion, thereby generating pepsin (the active form). Pepsin may then cleave the dietary proteins into smaller peptides.
  • Cellular localization
    Secreted

Images

  • ab159101 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159101 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159101.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up