Overview

  • Product name

    Recombinant Human Pepsinogen II/PGC protein (His tag)
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected insect cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      AVVKVPLKKFKSIRETMKEKGLLGEFLRTHKYDPAWKYRFGDLSVTYEPM AYMDAAYFGEISIGTPPQNFLVLFDTGSSNLWVPSVYCQSQACTSHSRFN PSESSTYSTNGQTFSLQYGSGSLTGFFGYDTLTVQSIQVPNQEFGLSENE PGTNFVYAQFDGIMGLAYPALSVDEATTAMQGMVQEGALTSPVFSVYLSN QQGSSGGAVVFGGVDSSLYTGQIYWAPVTQELYWQIGIEEFLIGGQASGW CSEGCQAIVDTGTSLLTVPQQYMSALLQATGAQEDEYGQFLVNCNSIQNL SLTFIINGVEFPLPPSSYILSNNGYCTVGVEPTYLSSQNGQPLWILGDVF LRSYYSVYDLGNNRVGFATAALEHHHHHH
    • Molecular weight

      42 kDa including tags
    • Amino acids

      17 to 388
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This is the mature protein and the propeptide sequence without the signal peptide sequence (NP_002621).

Specifications

Our Abpromise guarantee covers the use of ab219243 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    ab219243 was purified by using conventional chromatography techniques.
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Pepsinogen II

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 90% PBS, 10% Glycerol

General Info

  • Alternative names

    • Gastricsin
    • PEPC
    • PEPC_HUMAN
    • pepsin C
    • Pepsinogen C
    • pepsinogen group II
    • PGC
    • PGII
    • preprogastricsin
    • Progastricsin
    see all
  • Function

    Hydrolyzes a variety of proteins.
  • Sequence similarities

    Belongs to the peptidase A1 family.
    Contains 1 peptidase A1 domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab219243 (3µg).   

References

ab219243 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219243.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up