Description

  • Product name

    Recombinant Human Peptide YY/PYY protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPGEDASPEELNRYYA SLRHYLNLVTRQRYGKRDGPDRLLSKTFFPDGEDRPVRSRSEGPDLW
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      1 to 97
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab114446 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.

    Previously labelled as Peptide YY. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • GHYY
    • MGC19143
    • Peptide tyrosine tyrosine
    • peptide YY
    • Peptide YY like
    • Peptide YY precursor
    • Peptide YY(3-36)
    • Prepro PYY
    • PYY
    • PYY 1
    • PYY II
    • PYY-I
    • PYY-II
    • PYY_HUMAN
    • PYY1
    • RATGHYY
    • Yy
    see all
  • Function

    This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.
  • Sequence similarities

    Belongs to the NPY family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • ab114446 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114446 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114446.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up