Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ILAEKRAAAPVVSVPCIPPHRLSKITNRLTIQRKSQFMQRLHSYWTLKRQ SRNGVPLLRRLQTHLQSQRNCDQVGRDSEDKNWALKEQLKS
    • Amino acids
      500 to 590
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159902 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BR140
    • Bromodomain and PHD finger containing 1
    • Bromodomain and PHD finger-containing protein 1
    • bromodomain-containing protein, 140kD
    • BRPF1
    • BRPF1_HUMAN
    • Peregrin
    • Protein Br140
    see all
  • Function
    Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity. Positively regulates the transcription of RUNX1 and RUNX2.
  • Tissue specificity
    High levels in testis.
  • Sequence similarities
    Contains 1 bromo domain.
    Contains 1 C2H2-type zinc finger.
    Contains 1 PHD-type zinc finger.
    Contains 1 PWWP domain.
  • Post-translational
    modifications
    Acetylated by KAT6A.
  • Cellular localization
    Nucleus. Cytoplasm. Localization to the nucleus depends on KAT6A, ING5 and MEAF6.
  • Information by UniProt

Images

  • ab159902 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159902 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159902.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up