Overview

  • Product name

    Recombinant Human Peregrin/BRPF1 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MHHHHHHMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVTELDEVPD YLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIF YRAAVRLREQGGAVLRQARRQAEKMG
    • Molecular weight

      15 kDa including tags
    • Amino acids

      628 to 746
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab196416 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    >= 69 % SDS-PAGE.

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Peregrin

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.04% Tween, 20% Glycerol

General Info

  • Alternative names

    • BR140
    • Bromodomain and PHD finger containing 1
    • Bromodomain and PHD finger-containing protein 1
    • bromodomain-containing protein, 140kD
    • BRPF1
    • BRPF1_HUMAN
    • Peregrin
    • Protein Br140
    see all
  • Function

    Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity. Positively regulates the transcription of RUNX1 and RUNX2.
  • Tissue specificity

    High levels in testis.
  • Sequence similarities

    Contains 1 bromo domain.
    Contains 1 C2H2-type zinc finger.
    Contains 1 PHD-type zinc finger.
    Contains 1 PWWP domain.
  • Post-translational
    modifications

    Acetylated by KAT6A.
  • Cellular localization

    Nucleus. Cytoplasm. Localization to the nucleus depends on KAT6A, ING5 and MEAF6.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE analysis of 3 µg ab196416 with Coomassie staining.

References

ab196416 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196416.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up