Overview

  • Product name

    Recombinant Human Pericentrin 1/FROUNT protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MEELDGEPTVTLIPGVNSKKNQMYFDWGPGEMLVCETSFNKKEKSEMVPS CPFIYIIRKDVDVYSQILRKLFNESHGIFLGLQRIDEELTGKSRKSQLVR VSKNYRSVIRACMEEMHQVAIAAKDPANGRQFSSQVSILSAMELIWNLCE ILFIEVAPAGPLLLHLLDWVRLHVCEVDSLSADVLGSENPSKHDSFWNLV TILVLQGRLDEARQMLSKEADASPASAGICRIMGDLMRTMPILSPGNTQT LTELELKWQHWHEECERYLQDSTFATSPHLESLLKIMLGDEAALLEQKEL LSNWYHFLVTRLLYSNPTVKPIDLHYYAQSSLDLFLGGESSPEPLDNILL AAFEFDIHQVIKECSIALSNWWFVAHLTDLLDHCKLLQSHNLYFGSNMRE FLLLEYASGLFAHPSLWQLGVDYFDYCPELGRVSLELHIERIPLNTEQKA LKVLRICEQRQMTEQVRSICKILAMKAVRNNRLGSALSWSIRAKDAAFAT LVSDRFLRDYCERGCFSDLDLIDNLGPAMMLSDRLTFLGKYREFHRMYGE KRFADAASLLLSLMTSRIAPRSFWMTLLTDALPLLEQKQVIFSAEQTYEL MRCLEDLTSRRPVHGESDTEQLQDDDIETTKVEMLRLSLARNLARAIIRE GSLEGS
    • Molecular weight

      98 kDa including tags
    • Amino acids

      1 to 656

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132205 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.

    Protein previously labeled as Pericentrin 1.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 85 kDa nucleoporin
    • FLJ12549
    • FROUNT
    • Frount protein
    • Nuclear pore complex protein nucleoporin 85 kDa
    • nuclear pore complex protein nucleoporin Nup75
    • Nuclear pore complex protein Nup85
    • Nucleoporin 85
    • Nucleoporin 85kDa
    • Nucleoporin nucleoporin 85kDa
    • Nucleoporin Nup75
    • Nucleoporin NUP85
    • nucleoporin, 75-KD
    • Nucleoporin85
    • Nup 75
    • NUP 85
    • Nup75
    • nup85
    • NUP85_HUMAN
    • PCN
    • PCNT
    • PCNT 1
    • PCNT, formerly
    • PCNT1
    • Pericentrin
    • Pericentrin, formerly
    • Pericentrin-1
    • Pericentrin1
    see all
  • Function

    Essential component of the nuclear pore complex (NPC) that seems to be required for NPC assembly and maintenance. As part of the NPC Nup107-160 subcomplex plays a role in RNA export and in tethering NUP98/Nup98 and NUP153 to the nucleus. The Nup107-160 complex seems to be required for spindle assembly during mitosis. NUP85 is required for membrane clustering of CCL2-activated CCR2. Seems to be involved in CCR2-mediated chemotaxis of monocytes and may link activated CCR2 to the phosphatidyl-inositol 3-kinase-Rac-lammellipodium protrusion cascade.
  • Sequence similarities

    Belongs to the nucleoporin Nup85 family.
  • Cellular localization

    Nucleus > nuclear pore complex. Chromosome > centromere > kinetochore. Cytoplasm > cytoskeleton > spindle. Cytoplasm. Nucleus membrane. During mitosis, localizes to the kinetochores and spindle poles. Upon CCl2 stimulation translocates from the cytoplasm to the membrane and colocalizes with CCR2 at the front of migrating cells.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132205 stained with Coomassie Blue.

References

ab132205 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132205.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up