Description

  • Product name

    Recombinant Human Periostin protein
    See all Periostin proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGHHHHHHHHHHSSGHIEGRHMRNNHYDKILAHSRIRGRDQGPNVCALQQ ILGTKKKYFSTCKNWYKKSICGQKTTVLYECCPGYMRMEGMKGCPAVLPI DHVYGTLGIVGATTTQRYSDASKLREEIEGKGSFTYFAPSNEAWDNLDSD IRRGLESNVNVELLNALHSHMINKRMLTKDLKNGMIIPSMYNNLGLFINH YPNGVVTVNCARIIHGNQIATNGVVHVIDRVLTQIGTSIQDFIEAEDDLS SFRAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERFMGDKVASE ALMKYHILNTLQCSESIMGGAVFETLEGNTIEIGCDGDSITVNGIKMVNK KDIVTNNGVIHLIDQVLIPDSAKQVIELAGKQQTTFTDLVAQLGLASALR PDGEYTLLAPVNNAFSDDTLSMVQRLLKLILQNHILKVKVGLNELYNGQI LETIGGKQLRVFVYRTAVCIENSCMEKGSKQGRNGAIHIFREIIKPAEKS LHEKLKQDKRFSTFLSLLEAADLKELLTQPGDWTLFVPTNDAFKGMTSEE KEILIRDKNALQNIILYHLTPGVFIGKGFEPGVTNILKTTQGSKIFLKEV NDTLLVNELKSKESDIMTTNGVIHVVDKLLYPADTPVGNDQLLEILNKLI KYIQIKFVRGSTFKEIPVTVY
    • Predicted molecular weight

      75 kDa including tags
    • Amino acids

      22 to 669
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Also contains an Xa – cleavage site at amino acid 23.

Specifications

Our Abpromise guarantee covers the use of ab203522 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Lyophilised
  • Additional notes

    Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -80°C for long term storage. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after one week at 4°C.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 4.00

    0.05 M Acetate buffer

  • Reconstitution
    Add 0.1 M acetate buffer pH 4.0 to prepare a working stock solution of 0.5 mg/mL and let the lyophilized pellet dissolve completely. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10 µg/mL. In higher concentrations the solubility of this antigen is limited. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

General Info

  • Alternative names

    • Fasciclin-I like
    • MGC119510
    • MGC119511
    • OSF 2
    • OSF-2
    • OSF2
    • Osteoblast specific factor
    • Osteoblast specific factor 2
    • Osteoblast specific factor 2 (fasciclin I like)
    • Osteoblast-specific factor 2
    • PDLPOSTN
    • Periodontal ligament specific periostin
    • Periostin
    • Periostin isoform thy2
    • Periostin isoform thy4
    • Periostin isoform thy6
    • Periostin isoform thy8
    • Periostin osteoblast specific factor
    • PN
    • POSTN
    • POSTN_HUMAN
    • RP11 412K4.1
    see all
  • Function

    Binds to heparin. Induces cell attachment and spreading and plays a role in cell adhesion. May play a role in extracellular matrix mineralization.
  • Tissue specificity

    Widely expressed with highest levels in aorta, stomach, lower gastrointestinal tract, placenta, uterus and breast. Up-regulated in epithelial ovarian tumors. Not expressed in normal ovaries. Also highly expressed at the tumor periphery of lung carcinoma tissue but not within the tumor. Overexpressed in breast cancers.
  • Sequence similarities

    Contains 1 EMI domain.
    Contains 4 FAS1 domains.
  • Post-translational
    modifications

    Gamma-carboxyglutamate residues are formed by vitamin K dependent carboxylation. These residues are essential for the binding of calcium.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • 12% SDS-PAGE analysis of ab203522.

    Lane 1:  Reduced and heated sample, 5 μg/lane
    Lane 2:  Non-reduced and non-heated sample, 5 μg/lane

References

ab203522 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203522.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up