Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MKSDSSTSAAPLRGLGGPLRSSEPVRAVPARAPAVDLLEEAADLLVVHLD FRAALETCERAWQSLANHAVAEEPAGTSLEVKCSLCVVGIQALAEMDRWQ EVLSWVLQYYQVPEKLPPKVLELCILLYSKMQEPGAVLDVVGAWLQDPAN QNLPEYGALAEFHVQRVLLPLGCLSEAEELVVGSAAFGEERRLDVLQAIH TARQQQKQEHSGSEEAQKPNLEGSVSHKFLSLPMLVRQLWDSAVSHFFSL PFKKSLLAALILCLLVVRFDPASPSSLHFLYKLAQLFRWIRKAAFSRLYQ LRIRD
    • Amino acids

      1 to 305
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163172 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 4632428M11Rik
    • AI85321
    • FLJ20695
    • OTTMUSP00000033411
    • OTTMUSP00000033413
    • PBD7A
    • PBD7B
    • Peroxin 26
    • Peroxisome assembly protein 26
    • Peroxisome biogenesis disorder, complementation group 8
    • Peroxisome biogenesis disorder, complementation group A
    • Peroxisome biogenesis factor 26
    • PEX 26
    • PEX26M1T
    • Pex26pM1T
    see all
  • Relevance

    PEX26 is probably required for protein import into peroxisomes. It anchors PEX1 and PEX6 to peroxisome membranes, possibly to form heteromeric AAA ATPase complexes required for the import of proteins into peroxisomes. Defects in the PEX26 gene are the cause of peroxisome biogenesis disorder complementation group 8 (PBD-CG8), which is a a group of peroxisomal disorders arising from a failure of protein import into the peroxisomal membrane or matrix.
  • Cellular localization

    Peroxisome membrane.

Images

  • ab163172 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163172 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163172.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up