Description

  • Product name

    Recombinant Human PEX5/PER3 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAMRELVEAECGGANPLMKLAGHFTQDKALRQEGLRPGPWPPGAPASEAA SKPLGVASEDELVAEFLQDQNAPLVSRAPQTFKMDDLLAEMQQIEQSNFR QAPQRAPGVADLALSENWAQEFLAAGDAVDVTQDYNETDWSQEFISEVTD PLSVSPARWAEEYLEQSEEKLWLGEPEGTATDRWYDEYHPEEDLQHTASD FVAKVDDPKLANSEFLKFVRQIGEGQVSLESGAGSGRAQAEQWAAEFIQQ QGTSDAWVDQFTRPVNTSALDMEFERAKSAIELQAELEEMAKRDAEAHPW LSDYDDLTSATYDKGYQFEEENPLRDHPQPFEEGLRRLQEGDLPNAVLLF EAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMA LAVSFTNESLQRQACETLRDWLRYTPAYAHLVTPAEEGAGGAGLGPSKRI LGSLLSDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAV DCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRS RYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAMSENIWSTLR LALSMLGQSDAYGAADARDLSTLLTMFGLPQ
    • Amino acids

      1 to 631
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159293 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as PEX5

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ50634
    • FLJ50721
    • FLJ51948
    • PBD2A
    • PBD2B
    • Peroxin 5
    • Peroxin-5
    • Peroxisomal biogenesis factor 5
    • Peroxisomal C terminal targeting signal import receptor
    • Peroxisomal C-terminal targeting signal import receptor
    • Peroxisomal targeting signal 1 (SKL type) receptor
    • Peroxisomal targeting signal 1 receptor
    • Peroxisomal targeting signal import receptor
    • Peroxisomal targeting signal receptor 1
    • Peroxisome receptor 1
    • pex5
    • PEX5_HUMAN
    • PTS1 BP
    • PTS1 receptor
    • PTS1-BP
    • PTS1R
    • PXR1
    see all
  • Function

    Binds to the C-terminal PTS1-type tripeptide peroxisomal targeting signal (SKL-type) and plays an essential role in peroxisomal protein import.
  • Tissue specificity

    Detected in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
  • Involvement in disease

    Defects in PEX5 are a cause of adrenoleukodystrophy neonatal (NALD) [MIM:202370]. NALD is a peroxisome biogenesis disorder (PBD) characterized by the accumulation of very long-chain fatty acids, adrenal insufficiency and mental retardation. Inheritance is autosomal recessive.
    Defects in PEX5 are a cause of Zellweger syndrome (ZWS) [MIM:214100]. ZWS is a fatal peroxisome biogenesis disorder characterized by dysmorphic facial features, hepatomegaly, ocular abnormalities, renal cysts, hearing impairment, profound psychomotor retardation, severe hypotonia and neonatal seizures. Death occurs within the first year of life.
    Defects in PEX5 may be a cause of infantile Refsum disease (IRD) [MIM:266510]. IRD is a mild peroxisome biogenesis disorder (PBD). Clinical features include early onset, mental retardation, minor facial dysmorphism, retinopathy, sensorineural hearing deficit, hepatomegaly, osteoporosis, failure to thrive, and hypocholesterolemia. The biochemical abnormalities include accumulation of phytanic acid, very long chain fatty acids (VLCFA), di- and trihydroxycholestanoic acid and pipecolic acid.
  • Sequence similarities

    Belongs to the peroxisomal targeting signal receptor family.
    Contains 7 TPR repeats.
  • Cellular localization

    Cytoplasm. Peroxisome membrane. Its distribution appears to be dynamic. It is probably a cycling receptor found mainly in the cytoplasm and as well associated to the peroxisomal membrane through a docking factor.
  • Information by UniProt

Images

  • ab159293 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159293 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159293.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up