Description

  • Product name

    Recombinant Human PF4 protein
    See all PF4 proteins and peptides
  • Purity

    > 85 % SDS-PAGE.
    ab156343 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMEAEEDGDLQCLCVKTTSQVRPRHITSLEV IKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
    • Predicted molecular weight

      10 kDa including tags
    • Amino acids

      32 to 101
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab156343 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.03% DTT, 0.32% Tris HCl, 50% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names

    • C-X-C motif chemokine 4
    • Chemokine (C X C motif) ligand 4
    • Chemokine (CXC motif) ligand 4
    • chemokine ligand 4
    • CXCL 4
    • CXCL4
    • Iroplact
    • MGC138298
    • Oncostatin A
    • Oncostatin-A
    • OncostatinA
    • PF 4
    • PF-4
    • PF4
    • Pf4a
    • Platelet factor 4
    • PLF4_HUMAN
    • SCYB 4
    • SCYB4
    • short form
    • Small inducible cytokine subfamily B
    • Small inducible cytokine subfamily member 4
    see all
  • Function

    Released during platelet aggregation. Neutralizes the anticoagulant effect of heparin because it binds more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Chemotactic for neutrophils and monocytes. Inhibits endothelial cell proliferation, the short form is a more potent inhibitor than the longer form.
  • Sequence similarities

    Belongs to the intercrine alpha (chemokine CxC) family.
  • Post-translational
    modifications

    Binds non-covalently to a proteoglycan molecule.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab156343.

References

ab156343 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab156343.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up