Description

  • Product name

    Recombinant Human PFAS protein (Tagged)
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      RVAILREEGSNGDREMADAFHLAGFEVWDVTMQDLCSGAIGLDTFRGVAF VGGFSYADVLGSAKGWAAAVTFHPRAGAELRRFRKRPDTFSLGVCNGCQL LALLGWVGGDPNEDAAEMGPDSQPARPGLLLRHNLSGRYESRWASVRVGP GPALMLRGMEGAVLPVWSAHGEGYVAFSSPELQAQIEARGLAPLHWADDD GNPTEQYPLNPNGSPGGVAGICSCDGRHLAVMPHPERAV
    • Predicted molecular weight

      45 kDa including tags
    • Amino acids

      1064 to 1302
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged.

Specifications

Our Abpromise guarantee covers the use of ab236198 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • PFAS
    • FGAM synthase
    • FGAMS
    • FGAR amidotransferase
    • FGARAT
    • Formylglycinamide ribotide amidotransferase
    • Formylglycinamide ribotide synthetase
    • KIAA0361
    • Phosphoribosylformylglycinamidine synthase
    • PURL
    see all
  • Relevance

    Purines are necessary for many cellular processes, including DNA replication, transcription, and energy metabolism. Ten enzymatic steps are required to synthesize inosine monophosphate (IMP) in the de novo pathway of purine biosynthesis. PFAS catalyzes the fourth step of IMP biosynthesis.
  • Cellular localization

    Cytoplasmic

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel using ab236198.

References

ab236198 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236198.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up