Description

  • Product name

    Recombinant Human PFKFB1 protein (His tag)
    See all PFKFB1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 0.100 Eu/µg
  • Expression system

    Mammalian
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SPEMGELTQTRLQKIWIPHSSGSSRLQRRRGSSIPQFTNSPTMVIMVGLP ARGKTYISTKLTRYLNWIGTPTKVFNLGQYRREAVSYKNYEFFLPDNMEA LQIRKQCALAALKDVHNYLSHEEGHVAVFDATNTTRERRSLILQFAKEHG YKVFFIESICNDPGIIAENIRQVKLGSPDYIDCDREKVLEDFLKRIECYE VNYQPLDEELDSHLSYIKIFDVGTRYMVNRVQDHIQSRTVYYLMNIHVTP RSIYLCRHGESELNIRGRIGGDSGLSVRGKQYAYALANFIQSQGISSLKV WTSHMKRTIQTAEALGVPYEQWKALNEIDAGVCEEMTYEEIQEHYPEEFA LRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLL AYFLDKSSDELPYLKCPLHTVLKLTPVAYGCKVESIYLNVEAVNTHREKP ENVDITREPEEALDTVPAHYVDHHHHHH
    • Predicted molecular weight

      56 kDa including tags
    • Amino acids

      2 to 471
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab200300 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 0.87% Sodium chloride, 99% Phosphate Buffer

    Lyophilized from a 0.2 µm filtered solution

General Info

  • Alternative names

    • 6 phosphofructo 2 kinase/fructose 2 6 biphosphatase 1
    • 6-bisphosphatase
    • 6-P2ase 1
    • 6-P2ASE liver isozyme
    • 6PF 2 K/Fru 2 6 P2ASE liver isozyme
    • 6PF 2 K/Fru 2,6 P2ase 1
    • 6PF-2-K/Fru-2
    • F261_HUMAN
    • F6PK
    • Fructose 2 6 bisphosphatase
    • Fructose 6 phosphate 2 kinase:fructose 2 6 bisphosphatase
    • Fructose-2
    • HL2K
    • MGC116715
    • MGC116717
    • PFK/FBPase 1
    • PFKFB 1
    • Pfkfb1
    • PFRX
    see all
  • Function

    Synthesis and degradation of fructose 2,6-bisphosphate.
  • Tissue specificity

    Liver.
  • Sequence similarities

    In the C-terminal section; belongs to the phosphoglycerate mutase family.
  • Information by UniProt

References

ab200300 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200300.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up