Overview

  • Product name

    Recombinant Human PFKFB2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSGASSSEQNNNSYETKTPNLRMSEKKCSWASYMTNSPTLIVMIGLPARG KTYVSKKLTRYLNWIGVPTKVFNLGVYRREAVKSYKSYDFFRHDNEEAMK IRKQCALVALEDVKAYLTEENGQIAVFDATNTTRERRDMILNFAEQNSFK VFFVESVCDDPDVIAANILEVKVSSPDYPERNRENVMEDFLKRIECYKVT YRPLDPDNYDKDLSFIKVINVGQRFLVNRVQDYIQSKIVYYLMNIHVQPR TIYLCRHGESEFNLLGKIGGDSGLSVRGKQFAQALRKFLEEQEITDLKVW TSQLKRTIQTAESLGVPYEQWKILNEIDAGVCEEMTYAEIEKRYPEEFAL RDQEKYLYRYPGGESYQDLVQRLEPVIMELERQGNVLVISHQAVMRCLLA YFLDKGADELPYLRCPLHTIFKLTPVAYGCKVETIKLNVEAVNTHRDKPT NNFPKNQTPVRMRRNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRAQDM QEGAD
    • Molecular weight

      84 kDa including tags
    • Amino acids

      1 to 505
    • Tags

      proprietary tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab190406 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % Densitometry.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.29% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.002% DTT, 0.002% PMSF, 25% Glycerol

General Info

  • Alternative names

    • 6 phosphofructo 2 kinase/fructose 2 6 biphosphatase 2
    • 6-bisphosphatase
    • 6-P2ase 2
    • 6-P2ASE heart-type isozyme
    • 6PF 2 K/Fru 2 6 P2ASE heart type isozyme
    • 6PF-2-K/Fru-2
    • 6PF-2-K/Fru-26-P2ase 2
    • 6PF-2-K/Fru-26-P2ase heart-type isozyme
    • F262_HUMAN
    • Fructose 2 6 bisphosphatase cardiac isozyme
    • Fructose-2
    • PFK 2/FBPase 2
    • PFK/FBPase 2
    • PFKFB cardiac
    • PFKFB2
    see all
  • Function

    Synthesis and degradation of fructose 2,6-bisphosphate.
  • Tissue specificity

    Heart.
  • Sequence similarities

    In the C-terminal section; belongs to the phosphoglycerate mutase family.
  • Information by UniProt

Images

  • The purity of ab190406 was determined to be >90% by densitometry.

    Approximate MWt: 84 kDa

References

ab190406 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190406.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up