Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MPLELTQSRVQKIWVPVDHRPSLPRSCGPKLTNSPTVIVMVGLPARGKTY ISKKLTRYLNWIGVPTKVFNVGEYRREAVKQYSSYNFFRPDNEEAMKVRK QCALAALRDVKSYLAKEGGQIAVFDATNTTRERRHMILHFAKENDFKAFF IESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQP LDPDKCDRDLSLIKVIDVGRRFLVNRVQDHIQSRIVYYLMNIHVQPRTIY LCRHGENEHNLQGRIGGDAGLSSRGKKFASALSKFVEEQNLKDLRVWTSQ LKSTIQTAEALRLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQ DKYYYRYPTGESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFL DKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAK KGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAALPSCLPPEVPT QLPGQNMKGSRSSADSSRKH
    • Molecular weight

      83 kDa including tags
    • Amino acids

      1 to 520
    • Modifications

      mutated S269 A
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      NM_004566.

Specifications

Our Abpromise guarantee covers the use of ab207962 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 95 % Densitometry.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.29% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.002% PMSF, 0.004% DTT, 25% Glycerol

General Info

  • Alternative names

    • 6 phosphofructo 2 kinase/ fructose 2,6 bisphosphatase
    • 6 phosphofructo 2 kinase/fructose 2,6 biphosphatase 3
    • 6-bisphosphatase
    • 6-P2ase 3
    • 6-P2ASE brain/placenta-type isozyme
    • 6PF 2 K/Fru 2,6 P2ASE brain/placenta type isozyme
    • 6PF 2-K/Fru 2,6 P2ase 3
    • 6PF-2-K/Fru-2
    • F263_HUMAN
    • fructose 6 phosphate,2 kinase/fructose 2, 6 bisphosphatase
    • Fructose-2
    • Inducible 6 phosphofructo 2 kinase/fructose 2,6 bisphosphatase
    • iPFK 2
    • iPFK-2
    • IPFK2
    • PFK/FBPase 3
    • PFK2
    • PFKFB3
    • Renal carcinoma antigen NY REN 56
    • Renal carcinoma antigen NY-REN-56
    • uPFK
    see all
  • Function

    Synthesis and degradation of fructose 2,6-bisphosphate.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    In the C-terminal section; belongs to the phosphoglycerate mutase family.
  • Post-translational
    modifications

    Phosphorylation by AMPK stimulates activity.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab207962.

References

ab207962 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab207962.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up