Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      THEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFV HEGYQGLVDGGDHIKEATWESVSMMLQLGGTVIGSARCKDFREREGRLRA AYNLVKRGITNLCVIGGDGSLTGADTFRSEWSDLLSDLQKAGKITDEEAT KSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIMEIVDAITTTAQSHQR TFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWEEHLCRRLSETR TRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGYDTRVTVLGHVQR GGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMEC VQVTKDVTKAMDEKKFDEALKLRGRSFMNNWEVYKLLAHVRPPVSKSGSH TVAVMNVGAPAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEA GWSYVGGWTGQGGSKLGTKRTLPKKSFEQISANITKFNIQGLVIIGGFEA YTGGLELMEGRKQFDELCIPFVVIPATVSNNVPGSDFSVGADTALNTICT TCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPFT IRDLQANVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGI FDSRKNVLGHMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIF ANTPDSGCVLGMRKRALVFQPVAELKDQTDFEHRIPKEQWWLKLRPILKI LAKYEIDLDTSDHAHLEHITRKRSGEAAVVDHHHHHH
    • Molecular weight

      86 kDa including tags
    • Amino acids

      2 to 780
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein. The initiator methionine is not included.

Specifications

Our Abpromise guarantee covers the use of ab199591 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 0.100 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Determined by SEC-HPLC and reducing SDS-PAGE
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Fructose 6 Phosphate Kinase

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 0.87% Sodium chloride, 99% Phosphate Buffer

    Supplied as a 0.2 µm filtered solution

General Info

  • Alternative names

    • 6 Phosphofructokinase Muscle Type
    • 6-phosphofructokinase
    • 6-phosphofructokinase muscle type
    • EC 2.7.1.1
    • EC 2.7.1.11
    • GSD7
    • K6PF_HUMAN
    • MGC8699
    • muscle type
    • PFK, muscle type
    • PFK-A
    • PFKA
    • PFKL
    • PFKM
    • PFKP
    • PFKX
    • Phosphofructo 1 Kinase Isozyme A
    • Phosphofructo-1-kinase isozyme A
    • Phosphofructokinase 1
    • Phosphofructokinase M
    • Phosphofructokinase, muscle
    • Phosphofructokinase, muscle type
    • Phosphofructokinase, polypeptide X
    • Phosphofructokinase-M
    • Phosphohexokinase
    see all
  • Pathway

    Carbohydrate degradation; glycolysis; D-glyceraldehyde 3-phosphate and glycerone phosphate from D-glucose: step 3/4.
  • Involvement in disease

    Defects in PFKM are the cause of glycogen storage disease type 7 (GSD7) [MIM:232800]; also known as Tarui disease. GSD7 is an autosomal recessive disorder characterized by exercise intolerance with associated nausea and vomiting. Short bursts of intense activity are particularly difficult. Severe muscle cramps and myoglobinuria develop after vigorous exercise. Most patients obtain a "second wind" when the onset of exercise is followed by a brief rest period. In time patients adjust their activity level and are well compensated.
  • Sequence similarities

    Belongs to the phosphofructokinase family. Two domains subfamily.
  • Information by UniProt

References

ab199591 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab199591.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up