Overview

  • Product name

    Recombinant Human PFKP protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MDADDSRAPKGSLRKFLEHLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMG IYVGAKVYFIYEGYQGMVDGGSNIAEADWESVSSILQVGGTIIGSARCQA FRTREGRLKAACNLLQRGITNLCVIGGDGSLTGANLFRKEWSGLLEELAR NGQIDKEAVQKYAYLNVVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDA IMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLPESPPEEGWEE QMCVKLSENRARKKRLNIIIVAEGAIDTQNKPITSEKIKELVVTQLGYDT RVTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATPDTPACVVSLNGN HAVRLPLMECVQMTQDVQKAMDERRFQDAVRLRGRSFAGNLNTYKRLAIK LPDDQIPKTNCNVAVINVGAPAAGMNAAVRSAVRVGIADGHRMLAIYDGF DGFAKGQIKEIGWTDVGGWTGQGGSILGTKRVLPGKYLEEIATQMRTHSI NALLIIGGFEAYLGLLELSAAREKHEEFCVPMVMVPATVSNNVPGSDFSI GADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGA DAAYIFEEPFDIRDLQSNVEHLTEKMKTTIQRGLVLRNESCSENYTTDFI YQLYSEEGKGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMEWITAK LKEARGRGKKFTTDDSICVLGISKRNVIFQPVAELKKQTDFEHRIPKEQW WLKLRPLMKILAKYKASYDVSDSGQLEHVQPWSV
    • Molecular weight

      112 kDa including tags
    • Amino acids

      1 to 784

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132823 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris-HCl buffer, 0.31% Glutathione

General Info

  • Alternative names

    • 1200015H23Rik
    • 6 phosphofructokinase type C
    • 6 phosphofructokinase, platelet type
    • 6-phosphofructokinase
    • 6-phosphofructokinase type C
    • 9330125N24Rik
    • FLJ40226
    • K6PP
    • K6PP_HUMAN
    • MGC105718
    • PFK C
    • PFK, fibroblast type
    • PFK-C
    • PFKF
    • PFKP
    • Phosphofructo 1 kinase isozyme C
    • Phosphofructo-1-kinase isozyme C
    • Phosphofructokinase 1
    • Phosphofructokinase platelet
    • Phosphohexokinase
    • platelet type
    see all
  • Pathway

    Carbohydrate degradation; glycolysis; D-glyceraldehyde 3-phosphate and glycerone phosphate from D-glucose: step 3/4.
  • Sequence similarities

    Belongs to the phosphofructokinase family. Two domains subfamily.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132823 stained with Coomassie Blue

References

ab132823 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132823.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up